Recombinant Human Drosha Protein

Images

 
SDS-Page: Recombinant Human Drosha Protein [H00029102-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Drosha Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1099-1196 of Human RNASEN partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DROSHA

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Drosha Protein

  • drosha, double-stranded RNA-specific endoribonuclease
  • drosha, ribonuclease type III
  • EC 3.1.26.3
  • ETOHI2
  • nuclear RNase III Drosha
  • p241
  • Protein Drosha
  • putative protein p241 which interacts with transcription factor Sp1
  • putative ribonuclease III
  • RANSE3L
  • ribonuclease 3
  • Ribonuclease III
  • ribonuclease III, nuclear
  • RN3nuclear
  • RNase III

Background

Members of the ribonuclease III superfamily of double-stranded (ds) RNA-specific endoribonucleases participate in diverse RNA maturation and decay pathways in eukaryotic and prokaryotic cells (Fortin et al., 2002 [PubMed 12191433]). The RNase III Drosha is the core nuclease that executes the initiation step of microRNA (miRNA) processing in the nucleus (Lee et al., 2003 [PubMed 14508493]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06520
Species: Hu, Mu
Applications: WB, IP
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-90111
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-89605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24725
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-46198
Species: Hu
Applications: WB, IHC
NBP1-82485
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6486
Species: Hu
Applications: WB, Simple Western
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-351
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00029102-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Drosha Partial Recombinant Protein (H00029102-Q01) (0)

There are no publications for Drosha Partial Recombinant Protein (H00029102-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Drosha Partial Recombinant Protein (H00029102-Q01) (0)

There are no reviews for Drosha Partial Recombinant Protein (H00029102-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Drosha Partial Recombinant Protein (H00029102-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Drosha Products

Bioinformatics Tool for Drosha Partial Recombinant Protein (H00029102-Q01)

Discover related pathways, diseases and genes to Drosha Partial Recombinant Protein (H00029102-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Drosha Partial Recombinant Protein (H00029102-Q01)

Discover more about diseases related to Drosha Partial Recombinant Protein (H00029102-Q01).
 

Pathways for Drosha Partial Recombinant Protein (H00029102-Q01)

View related products by pathway.

PTMs for Drosha Partial Recombinant Protein (H00029102-Q01)

Learn more about PTMs related to Drosha Partial Recombinant Protein (H00029102-Q01).
 

Research Areas for Drosha Partial Recombinant Protein (H00029102-Q01)

Find related products by research area.

Blogs on Drosha

There are no specific blogs for Drosha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Drosha Antibody
NBP1-03349

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Drosha Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DROSHA