DRIL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DRIL1 Antibody [NBP1-89938] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & vesicles.
Immunohistochemistry-Paraffin: DRIL1 Antibody [NBP1-89938] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DRIL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARID3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DRIL1 Protein (NBP1-89938PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DRIL1 Antibody

  • ARID domain-containing 3A
  • ARID domain-containing protein 3A
  • AT rich interactive domain 3A (BRIGHT- like) protein
  • AT rich interactive domain 3A (BRIGHT- like)
  • AT rich interactive domain 3A (BRIGHT-like)
  • AT-rich interactive domain-containing protein 3A
  • B-cell regulator of IgH transcription
  • BRIGHT
  • dead ringer-like 1
  • Dead ringer-like protein 1
  • DRIL1dead ringer-like 1 (Drosophila)
  • DRIL3
  • DRX
  • E2F-binding protein 1
  • E2FBP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33596
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut
NBP1-90010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
AF4715
Species: Mu
Applications: WB
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56467
Species: Hu, Ca, Pm
Applications: WB
AF6897
Species: Hu, Mu
Applications: WB, IHC

Publications for DRIL1 Antibody (NBP1-89938) (0)

There are no publications for DRIL1 Antibody (NBP1-89938).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DRIL1 Antibody (NBP1-89938) (0)

There are no reviews for DRIL1 Antibody (NBP1-89938). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DRIL1 Antibody (NBP1-89938) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DRIL1 Products

Bioinformatics Tool for DRIL1 Antibody (NBP1-89938)

Discover related pathways, diseases and genes to DRIL1 Antibody (NBP1-89938). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DRIL1 Antibody (NBP1-89938)

Discover more about diseases related to DRIL1 Antibody (NBP1-89938).
 

Pathways for DRIL1 Antibody (NBP1-89938)

View related products by pathway.

PTMs for DRIL1 Antibody (NBP1-89938)

Learn more about PTMs related to DRIL1 Antibody (NBP1-89938).

Blogs on DRIL1

There are no specific blogs for DRIL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DRIL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARID3A
Entrez
Uniprot