DRIL1 Antibody - BSA Free

Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & vesicles.

Staining of human liver, placenta, testis and tonsil using Anti-ARID3A antibody NBP1-89938 (A) shows similar protein distribution across tissues to independent antibody NBP2-62705 (B).

Analysis in human placenta and liver tissues using NBP1-89938 antibody. Corresponding ARID3A RNA-seq data are presented for the same tissues.

Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

Staining of human tonsil shows moderate nuclear positivity in non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DRIL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DRIL1 Antibody - BSA Free (NBP1-89938) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQ
• Predicted Species: Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARID3A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DRIL1 Protein (NBP1-89938PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DRIL1 Antibody - BSA Free

• ARID domain-containing 3A
• ARID domain-containing protein 3A
• AT rich interactive domain 3A (BRIGHT- like) protein
• AT rich interactive domain 3A (BRIGHT- like)
• AT rich interactive domain 3A (BRIGHT-like)
• AT-rich interactive domain-containing protein 3A
• B-cell regulator of IgH transcription
• BRIGHT
• dead ringer-like 1
• Dead ringer-like protein 1
• DRIL1dead ringer-like 1 (Drosophila)
• DRIL3
• DRX
• E2F-binding protein 1
• E2FBP1

Background

DRIL1 encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARID3A
• Entrez:
  • 1820(Human)
• Uniprot:
  • Q99856(Human)