DRAK1 Antibody

Images

 
Western Blot: DRAK1 Antibody [NBP2-55328] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: DRAK1 Antibody [NBP2-55328] - Staining of human cell line PC-3 shows localization to nuclear speckles & plasma membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DRAK1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NISQMNLSYSEEEFDVLSESAVDFIRTLLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE
Specificity
Specificity of human DRAK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STK17A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
DRAK1 Knockout HeLa Cell Lysate
Control Peptide
DRAK1 Recombinant Protein Antigen (NBP2-55328PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DRAK1 Antibody

  • DAP kinase-related apoptosis-inducing protein kinase 1
  • DRAK1
  • DRAK1death-associated protein kinase-related 1
  • EC 2.7.11.1
  • serine/threonine kinase 17a (apoptosis-inducing)
  • serine/threonine kinase 17a
  • serine/threonine-protein kinase 17A
  • STK17A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92897
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6640
Species: Hu, Mu, Rt
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-06579
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-91684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-03077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC
NBP2-75449
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02477
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-56937
Species: Hu
Applications: WB
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD

Publications for DRAK1 Antibody (NBP2-55328) (0)

There are no publications for DRAK1 Antibody (NBP2-55328).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DRAK1 Antibody (NBP2-55328) (0)

There are no reviews for DRAK1 Antibody (NBP2-55328). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DRAK1 Antibody (NBP2-55328) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DRAK1 Products

Bioinformatics Tool for DRAK1 Antibody (NBP2-55328)

Discover related pathways, diseases and genes to DRAK1 Antibody (NBP2-55328). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DRAK1 Antibody (NBP2-55328)

Discover more about diseases related to DRAK1 Antibody (NBP2-55328).
 

Pathways for DRAK1 Antibody (NBP2-55328)

View related products by pathway.

PTMs for DRAK1 Antibody (NBP2-55328)

Learn more about PTMs related to DRAK1 Antibody (NBP2-55328).
 

Research Areas for DRAK1 Antibody (NBP2-55328)

Find related products by research area.

Blogs on DRAK1

There are no specific blogs for DRAK1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DRAK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STK17A