DRAK1 Antibody - BSA Free

Western Blot: DRAK1 Antibody [NBP1-84981] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: DRAK1 Antibody [NBP1-84981] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DRAK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DRAK1 Antibody - BSA Free (NBP1-84981) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RTLLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETKESIVTE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STK17A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DRAK1 Protein (NBP1-84981PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DRAK1 Antibody - BSA Free

• DAP kinase-related apoptosis-inducing protein kinase 1
• DRAK1
• DRAK1death-associated protein kinase-related 1
• EC 2.7.11.1
• serine/threonine kinase 17a (apoptosis-inducing)
• serine/threonine kinase 17a
• serine/threonine-protein kinase 17A
• STK17A

Background

DRAK1 is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STK17A