DRAK1 Antibody

Images

 
Western Blot: DRAK1 Antibody [NBP1-84981] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: DRAK1 Antibody [NBP1-84981] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DRAK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RTLLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETKESIVTE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STK17A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DRAK1 Protein (NBP1-84981PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DRAK1 Antibody

  • DAP kinase-related apoptosis-inducing protein kinase 1
  • DRAK1
  • DRAK1death-associated protein kinase-related 1
  • EC 2.7.11.1
  • serine/threonine kinase 17a (apoptosis-inducing)
  • serine/threonine kinase 17a
  • serine/threonine-protein kinase 17A
  • STK17A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56695
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
NBP1-76652
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02477
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55609
Species: Hu
Applications: WB, ICC/IF
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for DRAK1 Antibody (NBP1-84981) (0)

There are no publications for DRAK1 Antibody (NBP1-84981).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DRAK1 Antibody (NBP1-84981) (0)

There are no reviews for DRAK1 Antibody (NBP1-84981). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DRAK1 Antibody (NBP1-84981) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DRAK1 Products

Bioinformatics Tool for DRAK1 Antibody (NBP1-84981)

Discover related pathways, diseases and genes to DRAK1 Antibody (NBP1-84981). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DRAK1 Antibody (NBP1-84981)

Discover more about diseases related to DRAK1 Antibody (NBP1-84981).
 

Pathways for DRAK1 Antibody (NBP1-84981)

View related products by pathway.

PTMs for DRAK1 Antibody (NBP1-84981)

Learn more about PTMs related to DRAK1 Antibody (NBP1-84981).
 

Research Areas for DRAK1 Antibody (NBP1-84981)

Find related products by research area.

Blogs on DRAK1

There are no specific blogs for DRAK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DRAK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STK17A
Entrez