DPP6 Recombinant Protein Antigen

Images

 
There are currently no images for DPP6 Protein (NBP2-47481PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DPP6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DPP6.

Source: E. coli

Amino Acid Sequence: VKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DPP6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47481.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DPP6 Recombinant Protein Antigen

  • dipeptidyl aminopeptidase IV-related protein
  • dipeptidyl aminopeptidase-like protein 6
  • Dipeptidyl aminopeptidase-related protein
  • Dipeptidyl peptidase 6
  • Dipeptidyl peptidase IV-like protein
  • dipeptidyl peptidase IV-related protein
  • Dipeptidyl peptidase VI
  • dipeptidylpeptidase 6
  • dipeptidyl-peptidase 6
  • dipeptidylpeptidase VI
  • DPP VI
  • DPP6
  • DPPX
  • DPPXFLJ55680
  • MGC46605
  • VF2

Background

The Anthrax toxin receptor (ATR) was initially discovered as the tumor endothelial marker 8 (TEM8). This protein, which exists in three isoforms (36, 40, and 60 kDa), is highly expressed in tumor vessels as well as in the vasculature of developing embryos, suggesting that it may normally play a role in angiogenesis. However, it also acts as the receptor for anthrax toxin. Following the binding of this protein by the protective antigen (PA) of anthrax, PA is cleaved and heptamerizes to form the binding site for both edema factor (EF) and lethal factor (LF). This complex is then endocytosed by the cell; acidification in endosomes allows the release of EF and LF into the cytoplasm where they interfere with MAPK signaling and induce apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01249
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-52497
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
AF1180
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB300-279
Species: Ha, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
H00030819-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, WB
NBP1-81336
Species: Hu, In
Applications: IHC,  IHC-P, WB
NBP2-01830
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB600-804
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA
AF3715
Species: Hu
Applications: Dual ISH-IHC, IHC, IP, KO, Simple Western, WB
NBP2-38146
Species: Hu
Applications: IHC,  IHC-P
NBP2-92546
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-01521
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00030818-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP2-19020
Species: Bv, Hu, Mu, Po, Rt
Applications: WB
NB100-2466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-47481PEP
Species: Hu
Applications: AC

Publications for DPP6 Protein (NBP2-47481PEP) (0)

There are no publications for DPP6 Protein (NBP2-47481PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPP6 Protein (NBP2-47481PEP) (0)

There are no reviews for DPP6 Protein (NBP2-47481PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DPP6 Protein (NBP2-47481PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DPP6 Products

Blogs on DPP6.

The role of DNMT3A in development
Epigenetics is the study of heritable change in gene activity despite alteration of the hosts DNA sequence.  Change in gene activity done independently of the DNA sequence is achieved by way of histone and DNA methylation.  Gene silencing in DNA ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DPP6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DPP6