DPCR-1 Antibody

Images

 
Immunohistochemistry: DPCR-1 Antibody [NBP1-89995] - Staining in human stomach showing moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry: DPCR-1 Antibody [NBP1-89995] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPCR-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KTTSTTEKTTRTPEKPTLYSEKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPCR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DPCR-1 Protein (NBP1-89995PEP)
Publications
Read Publication using NBP1-89995.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DPCR-1 Antibody

  • bCX105N19.6
  • C6orf37
  • diffuse panbronchiolitis critical region 1
  • DPCR1
  • DPCR-1
  • MGC126710
  • MGC126712
  • PBLT
  • PBLTdiffuse panbronchiolitis critical region 1 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49507
Species: Hu
Applications: IHC
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
AF6349
Species: Hu, Mu, Rt
Applications: WB
NBL1-11392
Species: Hu
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-55967
Species: Hu
Applications: ICC/IF
H00007455-Q01
Species: Hu
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46246
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24535
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89995
Species: Hu
Applications: IHC, IHC-P

Publications for DPCR-1 Antibody (NBP1-89995)(1)

Reviews for DPCR-1 Antibody (NBP1-89995) (0)

There are no reviews for DPCR-1 Antibody (NBP1-89995). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DPCR-1 Antibody (NBP1-89995) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPCR-1 Products

Bioinformatics Tool for DPCR-1 Antibody (NBP1-89995)

Discover related pathways, diseases and genes to DPCR-1 Antibody (NBP1-89995). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPCR-1 Antibody (NBP1-89995)

Discover more about diseases related to DPCR-1 Antibody (NBP1-89995).
 

Pathways for DPCR-1 Antibody (NBP1-89995)

View related products by pathway.

Blogs on DPCR-1

There are no specific blogs for DPCR-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPCR-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPCR1
Entrez