Home » DOK4 » DOK4 Antibodies » DOK4 Antibody

DOK4 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: DOK4 Antibody [NBP2-33274] - Immunofluorescent staining of human cell line CACO-2 shows localization to microtubules & cytokinetic bridge.
Immunocytochemistry/ Immunofluorescence: DOK4 Antibody [NBP2-33274] - Immunofluorescent staining of human cell line CACO-2 shows localization to microtubules & cytokinetic bridge.
Immunohistochemistry-Paraffin: DOK4 Antibody [NBP2-33274] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

DOK4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QRLEKYPDEKSVCLRGCPKVTEISNVKCVTRLPKETKRQAVAIIFTDDSARTFTCDSEL
Specificity
Specificity of human DOK4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DOK4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DOK4 Protein (NBP2-33274PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DOK4 Antibody

  • docking protein 4
  • Downstream of tyrosine kinase 4
  • FLJ10488
  • Insulin receptor substrate 5
  • IRS5
  • IRS-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DOK5 Antibody
NB100-1463
Western Blot: DOK5 Antibody [NB100-1463] - Analysis of DOK5 in Human Kidney lysate (35 ug protein in RIPA buffer) using this antibody at 0.1 ug/ml.
Immunohistochemistry-Paraffin: DOK5 Antibody [NB100-1463] - IHC staining of paraffin embedded Human Tonsil using this antibody at 1 ug/ml. Microwaved antigen retrieval with citrate buffer pH6, HRP-staining.
Western Blot: DOK5 Antibody [NB100-1463] - HEK293 overexpressing DOK5 and probed with (mock transfection in first lane).
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Pleckstrin
Antibody (OTI6H8)
NBP2-02300
Western Blot: Pleckstrin Antibody (6H8) [NBP2-02300] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Pleckstrin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Pleckstrin.
Immunohistochemistry-Paraffin: Pleckstrin Antibody (6H8) [NBP2-02300] Staining of paraffin-embedded prostate tissue using anti-Pleckstrin mouse monoclonal antibody.
Flow Cytometry: Pleckstrin Antibody (6H8) [NBP2-02300] - HEK293T cells transfected with either pCMV6-ENTRY Pleckstrin.(Red) or empty vector control plasmid (Blue) were immunostained with anti-Pleckstrin mouse monoclonal, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver cancer tissue using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver array using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
DOK1 [p Tyr362]
Antibody
NB100-82112
Western Blot: DOK1 [p Tyr362] Antibody [NB100-82112] - Analysis of extracts from JK cells.
Immunohistochemistry-Paraffin: DOK1 [p Tyr362] Antibody [NB100-82112] - Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue, using p62Dok (phospho-Tyr362) antibody.
Western Blot: DOK1 [p Tyr362] Antibody [NB100-82112] - Analysis of extracts from Jurkat cells, using p62Dok (Ab-362) antibody ( Line 1 and 2) and p62Dok (phospho-Tyr362) antibody ( Line 3 and 4).
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
IRS1 Antibody
AF3978
Western blot shows lysates of MCF-7 human breast cancer cell line, HepG2 human hepatocellular carcinoma cell line, C2C12 mouse myoblast cell line, and PC-12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat IRS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3978) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for IRS1 at approximately 170 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
IRS1 was detected in immersion fixed paraffin-embedded sections of human liver cancer tissue using Goat Anti-Human/Mouse/Rat IRS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3978) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu, Mu, Rt
Applications: WB, IHC
Insulin Receptor
beta Antibody
NBP2-12793
Immunoprecipitation: Insulin Receptor Antibody [NBP2-12793] - Samples: Whole cell lysate from HeLa (15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 ug), Jurkat (J; 50 ug) and mouse NIH3T3 (M; 50 ug) cells. Antibodies: Affinity purified rabbit anti-Insulin Receptor Beta antibody NBP2-12793 used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 6 ug/mg lysate. Insulin Receptor Beta was also immunoprecipitated by rabbit anti-Insulin Receptor Beta antibody, which recognizes an upstream epitope. Detection: Chemiluminescence with exposure times of 30 seconds (A and B).
(1 Review)
Species: Hu, Mu
Applications: WB, IP
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Ret Antibody
[Unconjugated]
AF482
Ret was detected in perfusion fixed frozen sections of mouse spinal cord using Goat Anti-Mouse Ret Antigen Affinity-purified Polyclonal Antibody (Catalog # AF482) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to the ventral horn. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(21 Publications)
Species: Mu
Applications: WB, IHC
IRS4 Knockout 293T
Cell Lysate
NBP2-65920
IRS4 Knockout 293T Cell Lysate
Species: Hu
NCK1 Antibody
(714506)
MAB7008
Western blot shows lysates of A172 human glioblastoma cell line, MOLT‑4 human acute lymphoblastic leukemia cell line, BaF3 mouse pro-B cell line, and Y3‑Ag rat myeloid cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human NCK1 Monoclonal Antibody (Catalog # MAB7008) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for NCK1 at approximately 47 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
NCK1 was detected in immersion fixed MCF‑7 human breast cancer cell line using Mouse Anti-Human NCK1 Monoclonal Antibody (Catalog # MAB7008) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu
Applications: WB, ICC
Fyn Antibody
(FYN-01)
NB500-517
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in murine transformed fibroblasts using anti-Fyn (FYN-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human primary fibroblasts using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human HeLa cell line using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Jak2 [p Tyr1007, p
Tyr1008] Antibody (SY ...
NBP2-67429
Immunocytochemistry/Immunofluorescence: Jak2 [p Tyr1007, p Tyr1008] Antibody (SY24-03) [NBP2-67429] - Staining Phospho-JAK2(Y1007+Y1008) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Jak2 [p Tyr1007, p Tyr1008] Antibody (SY24-03) [NBP2-67429] - Analysis of paraffin-embedded human tonsil tissue using anti-Phospho-JAK2(Y1007+Y1008) antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: Jak2 [p Tyr1007, p Tyr1008] Antibody (SY24-03) [NBP2-67429] - Analysis of paraffin-embedded human spleen tissue using anti-Phospho-JAK2(Y1007+Y1008) antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Ras-GAP Antibody
AF5094
Western blot shows lysates of TT human medullary thyroid cancer cell line, C2C12 mouse myoblast cell line, and Rat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse/Rat Ras‑GAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5094) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Ras‑GAP at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
IRS2 Antibody
[Unconjugated]
AF6347
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line. PVDF Membrane was probed with 2 µg/mL of Sheep Anti-Human IRS2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6347) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for IRS2 at approximately 170-190 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Species: Hu
Applications: WB
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
ART4 Antibody
H00000420-B01P
Western Blot: ART4 Antibody [H00000420-B01P] - Analysis of ART4 expression in MCF-7.
Western Blot: ART4 Antibody [H00000420-B01P] - Analysis of ART4 expression in transfected 293T cell line by ART4 polyclonal antibody. Lane 1: ART4 transfected lysate(34.54 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: WB

Publications for DOK4 Antibody (NBP2-33274) (0)

There are no publications for DOK4 Antibody (NBP2-33274).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOK4 Antibody (NBP2-33274) (0)

There are no reviews for DOK4 Antibody (NBP2-33274). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DOK4 Antibody (NBP2-33274) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DOK4 Products

Bioinformatics Tool for DOK4 Antibody (NBP2-33274)

Discover related pathways, diseases and genes to DOK4 Antibody (NBP2-33274). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOK4 Antibody (NBP2-33274)

Discover more about diseases related to DOK4 Antibody (NBP2-33274).
 

Pathways for DOK4 Antibody (NBP2-33274)

View related products by pathway.

PTMs for DOK4 Antibody (NBP2-33274)

Learn more about PTMs related to DOK4 Antibody (NBP2-33274).

Blogs on DOK4

There are no specific blogs for DOK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DOK4 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol DOK4
Uniprot