DOCK1 Antibody (3D10)

Images

 
Western Blot: DOCK1 Antibody (3D10) [H00001793-M02] - DOCK1 monoclonal antibody (M02), clone 3D10. Analysis of DOCK1 expression in human colon.
Sandwich ELISA: DOCK1 Antibody (3D10) [H00001793-M02] - Detection limit for recombinant GST tagged DOCK1 is 10 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DOCK1 Antibody (3D10) Summary

Immunogen
DOCK1 (NP_001371, 698 a.a. ~ 803 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPT
Specificity
DOCK1 - dedicator of cytokinesis 1 (3D10)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DOCK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DOCK1 Antibody (3D10)

  • 180 kDa protein downstream of CRK
  • ced5
  • dedicator of cytokinesis 1
  • dedicator of cyto-kinesis 1
  • DOCK1
  • DOCK180
  • DOCK180dedicator of cytokinesis protein 1
  • DOwnstream of CrK

Background

This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-33645
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
AF6260
Species: Hu
Applications: WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NB100-879
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB100-873
Species: Hu
Applications: IHC, PEP-ELISA, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00001434-M08
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB

Publications for DOCK1 Antibody (H00001793-M02) (0)

There are no publications for DOCK1 Antibody (H00001793-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOCK1 Antibody (H00001793-M02) (0)

There are no reviews for DOCK1 Antibody (H00001793-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DOCK1 Antibody (H00001793-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DOCK1 Products

Array H00001793-M02

Bioinformatics Tool for DOCK1 Antibody (H00001793-M02)

Discover related pathways, diseases and genes to DOCK1 Antibody (H00001793-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOCK1 Antibody (H00001793-M02)

Discover more about diseases related to DOCK1 Antibody (H00001793-M02).
 

Pathways for DOCK1 Antibody (H00001793-M02)

View related products by pathway.

PTMs for DOCK1 Antibody (H00001793-M02)

Learn more about PTMs related to DOCK1 Antibody (H00001793-M02).
 

Research Areas for DOCK1 Antibody (H00001793-M02)

Find related products by research area.

Blogs on DOCK1

There are no specific blogs for DOCK1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DOCK1 Antibody (3D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol DOCK1
Entrez
Uniprot