Home » DOCK1 » DOCK1 Antibodies » DOCK1 Antibody (3D10)

DOCK1 Antibody (3D10)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: DOCK1 Antibody (3D10) [H00001793-M02] - DOCK1 monoclonal antibody (M02), clone 3D10. Analysis of DOCK1 expression in human colon.
Western Blot: DOCK1 Antibody (3D10) [H00001793-M02] - DOCK1 monoclonal antibody (M02), clone 3D10. Analysis of DOCK1 expression in human colon.
Sandwich ELISA: DOCK1 Antibody (3D10) [H00001793-M02] - Detection limit for recombinant GST tagged DOCK1 is 10 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

DOCK1 Antibody (3D10) Summary

Immunogen
DOCK1 (NP_001371, 698 a.a. ~ 803 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPT
Specificity
DOCK1 - dedicator of cytokinesis 1 (3D10)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DOCK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DOCK1 Antibody (3D10)

  • 180 kDa protein downstream of CRK
  • ced5
  • dedicator of cytokinesis 1
  • dedicator of cyto-kinesis 1
  • DOCK1
  • DOCK180
  • DOCK180dedicator of cytokinesis protein 1
  • DOwnstream of CrK

Background

This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(27 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Crk Antibody
(3G11E8)
NBP2-37568
ELISA: Crk Antibody (3G11E8) [NBP2-37568] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: Crk Antibody (3G11E8) [NBP2-37568] - Western blot analysis using CRK mAb against human CRK (AA: 1-204) recombinant protein. (Expected MW is 48.4 kDa)
Western Blot: Crk Antibody (3G11E8) [NBP2-37568] - Western blot analysis using CRK mAb against HEK293 (1) and CRK(AA: 1-204)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ELMO1 Antibody
NBP1-33645
Immunocytochemistry/Immunofluorescence: ELMO1 Antibody [NBP1-33645] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: ELMO1 Antibody [NBP1-33645] - Human stomach, using ELMO1antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: ELMO1 Antibody [NBP1-33645] - Sample (30 ug of whole cell lysate) A: H1299 12% SDS PAGE; antibody diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Rac1 Antibody
NB100-91266
Western Blot: Rac1 Antibody [NB100-91266] - WB on tissue lysates. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution: 1:1000 incubated overnight at 4C.
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat spinal cord (ventral horn) using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat ligated sciatic nerve using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
SOS1 Antibody
(SOS-01) - BSA Free
NB110-68800
Western Blot: SOS1 Antibody (SOS-01) [NB110-68800] - Analysis (reducing conditions) of human Sos using anti-human Sos (SOS-1). Lane 1: K562 human Caucasian chronic myeloid leukemia cell line Lane 2: RAJI human Burkitt lymphoma cell line
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in human primary fibroblasts using anti-Sos (SOS-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in murine transformed fibroblasts using anti-Sos (SOS-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Species: Hu, Mu
Applications: ICC/IF, WB
SOS2 Antibody
[Unconjugated]
AF6260
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line and 293T human embryonic kidney cell line. PVDF Membrane was probed with 2 µg/mL of Goat Anti-Human SOS2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6260) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for SOS2 at approximately 160 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
RASGRF1 Antibody
NBP1-85727
Immunohistochemistry-Paraffin: RASGRF1 Antibody [NBP1-85727] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: RASGRF1 Antibody [NBP1-85727] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & the Golgi apparatus. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
p130Cas/BCAR1
Antibody (OTI1A9)
NBP2-00532
Flow Cytometry: BCAR1 Antibody (1A9) [NBP2-00532] - Analysis of Hela cells, using anti-BCAR1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: BCAR1 Antibody (1A9) [NBP2-00532] - Analysis of Jurkat cells, using anti-BCAR1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: BCAR1 Antibody (1A9) [NBP2-00532] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-BCAR1 antibody, and then analyzed by flow cytometry.
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SLC2A4RG Antibody
(4C10)
H00056731-M02
Western Blot: SLC2A4RG Antibody (4C10) [H00056731-M02] - SLC2A4RG monoclonal antibody (M02), clone 4C10 Analysis of SLC2A4RG expression in HeLa.
Immunocytochemistry/Immunofluorescence: SLC2A4RG Antibody (4C10) [H00056731-M02] - Analysis of monoclonal antibody to SLC2A4RG on HeLa cell. Antibody concentration 10 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, WB
GEF-H1 Antibody
NBP2-21577
Western Blot: GEF-H1 Antibody [NBP2-21577] - A. 30 ug 293T whole cell lysate/extract B. 30 ug A431 whole cell lysate/extract C. 30 ug HeLa whole cell lysate/extract D. 30 ug HepG2 whole cell lysate/extract5% SDS-PAGE GEF-H1 antibody dilution: 1:2000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: GEF-H1 Antibody [NBP2-21577] - A. 30 ug Neuro2A whole cell lysate/extract B. 30 ug GL261 whole cell lysate/extract C. 30 ug C8D30 whole cell lysate/extract D. 30 ug NIH-3T3 whole cell lysate/extract E. 30 ug BCL-1 whole cell lysate/extract F. 30 ug Raw 264.7 whole cell lysate/extract G. 30 ug C2Cl2 whole cell lysate/extract 5% SDS-PAGEGEF-H1 antibody dilution: 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: GEF-H1 Antibody [NBP2-21577] - A. 30 ug 293T whole cell lysate/extract B. 30 ug A431 whole cell lysate/extract C. 30 ug HeLa whole cell lysate/extract D. 30 ug HepG2 whole cell lysate/extract5% SDS-PAGE GEF-H1 antibody dilution: 1:2000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
CDC42 Antibody
(JJ086-04)
NBP2-67895
Flow Cytometry: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of Hela cells with CDC42 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunohistochemistry-Paraffin: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-CDC42 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: CDC42 Antibody (JJ086-04) [NBP2-67895] - Analysis of paraffin-embedded human pancreas tissue using anti-CDC42 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
ELMO2 Antibody
NB100-879
Immunohistochemistry-Paraffin: ELMO2 Antibody [NB100-879] - Staining of Human Prostate. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: ELMO2 Antibody [NB100-879] - Analysis of ELMO in Human Brain lysate (RIPA buffer, 30ug total protein per lane). Primary incubated for 12 hour. Detected by western blot using chemiluminescence.
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
ELMO3 Antibody
NB100-873
Western Blot: ELMO3 Antibody [NB100-873] - (0.1ug/ml) of Human Brain (Hipoocampus) lysate (RIPA buffer, 35ug total protein per lane). Primary incubated for 1 hour. Detected by chemiluminescence.
Western Blot: ELMO3 Antibody [NB100-873] - Staining (2ug/ml) of Mouse Brain lysate (RIPA buffer, 35ug total protein per lane). Primary incubated for 1 hour. Detected by western blot using chemiluminescence.
Western Blot: ELMO3 Antibody [NB100-873] - Western blot analysis of ELMO3 in Human Brain lysate using NB100-873 at 2 ug/ ml.
(1 Publication)
Species: Hu
Applications: IHC, PEP-ELISA, WB
Rhodopsin Antibody
(B630)
NBP2-25160
Immunohistochemistry: Rhodopsin Antibody (B630) [NBP2-25160] - Rhodopsin expression and the prevalence of rod photoreceptors in the canine retina. (A) Fluorescence micrographs showing rhodopsin expression (red) in the ABCA4+/+ (left), ABCA4+/- (middle), and ABCA4-/- (right) rod outer segments. Scale bar = 10 um. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Western Blot: Rhodopsin Antibody (B630) [NBP2-25160] - Western blot analyses of ABCA4 (above), GAPDH (middle), and RHO (below) protein levels in retinal tissue of dogs with the three different genotypes. Image collected and cropped by CiteAb from the following publication. 50 ug of protein samples were resolved by SDS-PAGE, transferred to nitrocellulose membrane, and immunoblotted with the following primary antibodies: ABCA4 (NBP1-30032, 1:1000) and Rhodopsin (NBP2-25160, 1:5000), followed by Anti-Mouse IgG horseradish peroxidase-conjugated secondary antibody (R&D Systems, HAF007, 1:5000. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (B630) [NBP2-25160] - High magnification confocal image of pig retinal section stained with NBP2-25160 (Green). Rhodopsin is most abundant in the rod outer segments (ROS) of retina, clearly localized in rod membranes. The rod inner segments (RIS) and rod nuclei in the outer nuclear layer (ONL) are also seen in this image. Nuclear DNA was stained with DAPI (blue).
(4 Publications)
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
RhoD Antibody
NBP1-58359
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm and membrane of bronchial epithelial tissue Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X.
Species: Hu
Applications: IHC, IHC-P, WB
p120-catenin
Antibody (OTI2E8)
NBP2-45646
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Carcinoma of Human kidney tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Carcinoma of Human prostate tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB

CSE1L/CAS/Exportin-2 A
H00001434-M08
Western Blot: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Analysis of CSE1L expression in Hela S3 NE (Cat # L013V3).
Immunohistochemistry-Paraffin: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Mouse prostate tissue section stained with primary antibody for 10 hrs. IHC-P image submitted by a verified customer review.
ELISA: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Detection limit for recombinant GST tagged CSE1L is approximately 3ng/ml as a capture antibody.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, Simple Western, WB

Publications for DOCK1 Antibody (H00001793-M02) (0)

There are no publications for DOCK1 Antibody (H00001793-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOCK1 Antibody (H00001793-M02) (0)

There are no reviews for DOCK1 Antibody (H00001793-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DOCK1 Antibody (H00001793-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DOCK1 Products

Array H00001793-M02

Bioinformatics Tool for DOCK1 Antibody (H00001793-M02)

Discover related pathways, diseases and genes to DOCK1 Antibody (H00001793-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOCK1 Antibody (H00001793-M02)

Discover more about diseases related to DOCK1 Antibody (H00001793-M02).
 

Pathways for DOCK1 Antibody (H00001793-M02)

View related products by pathway.

PTMs for DOCK1 Antibody (H00001793-M02)

Learn more about PTMs related to DOCK1 Antibody (H00001793-M02).
 

Research Areas for DOCK1 Antibody (H00001793-M02)

Find related products by research area.

Blogs on DOCK1

There are no specific blogs for DOCK1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DOCK1 Antibody (3D10) and receive a gift card or discount.


Bioinformatics

Gene Symbol DOCK1
Entrez
Uniprot