DNASE2B Antibody

Images

 
Western Blot: DNASE2B Antibody [NBP1-69308] - This Anti-DNASE2B antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNASE2B Antibody Summary

Immunogen
Synthetic peptides corresponding to DNASE2B(deoxyribonuclease II beta) The peptide sequence was selected from the N terminal of DNASE2B. Peptide sequence EGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTTRSWRKSEQLMNDTKS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNASE2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DNASE2B and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DNASE2B Antibody

  • deoxyribonuclease II betaDNase2-like acid DNase
  • DLADdeoxyribonuclease-2-beta
  • DNase II beta
  • DNase II-like acid DNase
  • EC 3.1.22.1
  • Endonuclease DLAD
  • lysosomal DNase II

Background

DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs. The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this gene product is restricted to the salivary gland and lungs. The gene has been localized to chromosome 1p22.3 adjacent (and in opposite orientation) to the uricase pseudogene. Two transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13592
Species: Hu
Applications: WB
NBP1-76971
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
MAB2520
Species: Mu
Applications: WB, IHC, IP
AF6235
Species: Hu
Applications: WB
MAB5457
Species: Hu, Mu, Rt
Applications: WB
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-03828
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB600-934
Species: Ba
Applications: WB, ELISA, IP
NBP1-90320
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76471
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF
AF2727
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-69308
Species: Hu
Applications: WB

Publications for DNASE2B Antibody (NBP1-69308) (0)

There are no publications for DNASE2B Antibody (NBP1-69308).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNASE2B Antibody (NBP1-69308) (0)

There are no reviews for DNASE2B Antibody (NBP1-69308). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNASE2B Antibody (NBP1-69308) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNASE2B Products

Bioinformatics Tool for DNASE2B Antibody (NBP1-69308)

Discover related pathways, diseases and genes to DNASE2B Antibody (NBP1-69308). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNASE2B Antibody (NBP1-69308)

Discover more about diseases related to DNASE2B Antibody (NBP1-69308).

Blogs on DNASE2B

There are no specific blogs for DNASE2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNASE2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNASE2B
Uniprot