DNASE1L2 Antibody

Western Blot: DNASE1L2 Antibody [NBP1-91429] - Titration: 0.2-1 ug/ml, Positive Control: Rat Muscle.

Product Discontinued

DNASE1L2 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of human LOC100364462. Peptide sequence LIPLHAAPNQAVAEIDALYDVYLDVIDKWNTDDMLFLGDFNADCKYVKAH. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNASE1L2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DNASE1L2 Antibody

• deoxyribonuclease I-like 2
• deoxyribonuclease-1-like 2
• DHP1
• DNAS1L2
• DNase I homolog protein DHP1
• DNase I-like 2

Background

DNASE1L2 is a gene that codes for a protein located in the brain that is 299 amino acids long and weighs approximately 33 kDa. Current research is being done on diseases and disorders linked to this gene including kidney disease. DNASE1L2 has also been shown to have interactions with ABL1 and FYN.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNASE1L2
• Uniprot:
  • XP_002724704(Rat)