DNAJC7 Recombinant Protein Antigen

Images

 
There are currently no images for DNAJC7 Protein (NBP1-86920PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DNAJC7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAJC7.

Source: E.coli

Amino Acid Sequence: ATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVME

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DNAJC7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-86920.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for DNAJC7 Recombinant Protein Antigen

  • DANJC7
  • DJ11
  • DnaJ (Hsp40) homolog, subfamily C, member 7
  • tetratricopeptide repeat domain 2
  • Tetratricopeptide repeat protein 2
  • TPR repeat protein 2
  • TPR2DJC7
  • TTC2dnaJ homolog subfamily C member 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, KD
NBP1-86921
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-38988
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010963-M35
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-97503
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Gp, Ha, Md, Pm, Rb, Sh, Xp
Applications: WB, IHC, IHC-P, IP
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00010049-M01
Species: Hu
Applications: ICC/IF (-), WB, ELISA
NBP2-47427
Species: Hu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-74883
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31164
Species: Hu
Applications: WB, ICC/IF
NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DNAJC7 Protein (NBP1-86920PEP) (0)

There are no publications for DNAJC7 Protein (NBP1-86920PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC7 Protein (NBP1-86920PEP) (0)

There are no reviews for DNAJC7 Protein (NBP1-86920PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNAJC7 Protein (NBP1-86920PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional DNAJC7 Products

Bioinformatics Tool for DNAJC7 Protein (NBP1-86920PEP)

Discover related pathways, diseases and genes to DNAJC7 Protein (NBP1-86920PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC7 Protein (NBP1-86920PEP)

Discover more about diseases related to DNAJC7 Protein (NBP1-86920PEP).
 

Pathways for DNAJC7 Protein (NBP1-86920PEP)

View related products by pathway.

Blogs on DNAJC7

There are no specific blogs for DNAJC7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Bcl-2 Antibody
NB100-56098

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNAJC7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC7