Recombinant Human DNAJC22 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human DNAJC22 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-341 of Human FLJ13236 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQANRAQGQRQSPRGVTPPLSPIRFAAQVIVGIYFGLVALISLSSMVNFYIVALPLAVGLGVLLVAAVGNQTSDFKNTLGSAFLTSPIFYGRPIAILPISVAASITAQRHRRYKALVASEPLSVRLYRLGLAYLAFTGPLAYSALCNTAATLSYVAETFGSFLNWFSFFPLLGRLMEFVLLLPYRIWRLLMGETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKPWGSRR

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
DNAJC22
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
64.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DNAJC22 Protein

  • DnaJ (Hsp40) homolog, subfamily C, member 22
  • dnaJ homolog subfamily C member 22
  • FLJ13236
  • wurst homolog
  • wus

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-11538
Species: Hu, Mu, Rt
Applications: WB, IHC-P
7270-IL/CF
Species: Hu
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP1-84498
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30448
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF2209
Species: Hu
Applications: WB, ELISA, IHC
NBP1-86595
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB7670
Species: Hu
Applications: WB, ICC
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
H00079962-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for DNAJC22 Recombinant Protein (H00079962-P01) (0)

There are no publications for DNAJC22 Recombinant Protein (H00079962-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC22 Recombinant Protein (H00079962-P01) (0)

There are no reviews for DNAJC22 Recombinant Protein (H00079962-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNAJC22 Recombinant Protein (H00079962-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for DNAJC22 Recombinant Protein (H00079962-P01)

Discover related pathways, diseases and genes to DNAJC22 Recombinant Protein (H00079962-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for DNAJC22 Recombinant Protein (H00079962-P01)

View related products by pathway.

Blogs on DNAJC22

There are no specific blogs for DNAJC22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DNAJC22 Antibody
NBP2-58463
IL-6 [Unconjugated]
7270-IL-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DNAJC22 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC22