DNAH12 Antibody


Immunohistochemistry-Paraffin: DNAH12 Antibody [NBP1-90586] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: DNAH12 Antibody [NBP1-90586] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: DNAH12 Antibody [NBP1-90586] - Staining in human fallopian tube and prostate tissues using anti-DNAH12 antibody. Corresponding DNAH12 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

DNAH12 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCP
Specificity of human DNAH12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNAH12 Recombinant Protein Antigen (NBP1-90586PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DNAH12 Antibody

  • axonemal beta dynein heavy chain 12
  • axonemal dynein heavy chain isotype3
  • axonemal, heavy polypeptide 12
  • ciliary dynein heavy chain 12
  • DHC3
  • DLP12
  • DNAH12L
  • DNAH7L
  • DNAHC12
  • DNAHC3
  • DNHD2
  • dynein heavy chain 12, axonemal
  • dynein heavy chain domain-containing protein 2
  • dynein, axonemal, heavy chain 12
  • dynein, heavy chain-5
  • FLJ40427
  • FLJ44290
  • HDHC3
  • HL19
  • HL-19


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DNAH12 Antibody (NBP1-90586) (0)

There are no publications for DNAH12 Antibody (NBP1-90586).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAH12 Antibody (NBP1-90586) (0)

There are no reviews for DNAH12 Antibody (NBP1-90586). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNAH12 Antibody (NBP1-90586) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DNAH12 Products

Bioinformatics Tool for DNAH12 Antibody (NBP1-90586)

Discover related pathways, diseases and genes to DNAH12 Antibody (NBP1-90586). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAH12 Antibody (NBP1-90586)

Discover more about diseases related to DNAH12 Antibody (NBP1-90586).

Pathways for DNAH12 Antibody (NBP1-90586)

View related products by pathway.

Blogs on DNAH12

There are no specific blogs for DNAH12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DNAH12 Antibody and receive a gift card or discount.


Gene Symbol DNAH12