DNAH12 Antibody

Images

 
Immunohistochemistry-Paraffin: DNAH12 Antibody [NBP1-90586] - Staining of human fallopian tube shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAH12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAH12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNAH12 Recombinant Protein Antigen (NBP1-90586PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAH12 Antibody

  • axonemal beta dynein heavy chain 12
  • axonemal dynein heavy chain isotype3
  • axonemal, heavy polypeptide 12
  • ciliary dynein heavy chain 12
  • DHC3
  • DLP12
  • DNAH12L
  • DNAH7L
  • DNAHC12
  • DNAHC3
  • DNHD2
  • dynein heavy chain 12, axonemal
  • dynein heavy chain domain-containing protein 2
  • dynein, axonemal, heavy chain 12
  • dynein, heavy chain-5
  • FLJ40427
  • FLJ44290
  • HDHC3
  • HL19
  • HL-19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-94086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89750
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87535
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87527
Species: Hu
Applications: IHC, IHC-P
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
46530002
Species: Hu
Applications: ELISA
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46837
Species: Hu, Mu
Applications: WB, IP
NBP1-90443
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DNAH12 Antibody (NBP1-90586) (0)

There are no publications for DNAH12 Antibody (NBP1-90586).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAH12 Antibody (NBP1-90586) (0)

There are no reviews for DNAH12 Antibody (NBP1-90586). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNAH12 Antibody (NBP1-90586) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAH12 Products

Bioinformatics Tool for DNAH12 Antibody (NBP1-90586)

Discover related pathways, diseases and genes to DNAH12 Antibody (NBP1-90586). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAH12 Antibody (NBP1-90586)

Discover more about diseases related to DNAH12 Antibody (NBP1-90586).
 

Pathways for DNAH12 Antibody (NBP1-90586)

View related products by pathway.

Blogs on DNAH12

There are no specific blogs for DNAH12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAH12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAH12