DNA Primase small subunit Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

DNA Primase small subunit Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRIM1.
  
  

  Source: E. coli

  Amino Acid Sequence: ELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PRIM1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90897.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNA Primase small subunit Recombinant Protein Antigen

• DNA primase 1
• DNA primase 49 kDa subunit
• DNA primase small subunit
• DNA primase subunit 48
• EC 2.7.7
• EC 2.7.7.-
• MGC12308
• p49
• primase p49 subunit
• primase polypeptide 1, 49kDa
• primase, DNA, polypeptide 1 (49kDa)

Background

DNA Primase small subunit, also known by its gene name PRIM1, is a heterodimer that is composed of a small and large subunit. PRIM1 is 420 amino acids long and approximately 49kDa. The DNA Primase small subunit synthesizes RNA primers for the Okazaki fragments created during discontinuous DNA replication. Current research surrounding PRIM1 has shown a possible link with carcinomas, malaria, neuronitis, and osteosarcoma. DNA Primase small subunit has also been shown to interact with Histone cluster 1 H4/A, H4/B, H4/C, H4/D and H4/E in pathways such as DNA replication, DNA strand elongation, polymerase switching, and lagging strand synthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PRIM1