We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DNA Primase small subunit Recombinant Protein Antigen

Images

 
There are currently no images for DNA Primase small subunit Protein (NBP1-90897PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DNA Primase small subunit Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRIM1.

Source: E. coli

Amino Acid Sequence: ELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRIM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90897.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNA Primase small subunit Recombinant Protein Antigen

  • DNA primase 1
  • DNA primase 49 kDa subunit
  • DNA primase small subunit
  • DNA primase subunit 48
  • EC 2.7.7
  • EC 2.7.7.-
  • MGC12308
  • p49
  • primase p49 subunit
  • primase polypeptide 1, 49kDa
  • primase, DNA, polypeptide 1 (49kDa)

Background

DNA Primase small subunit, also known by its gene name PRIM1, is a heterodimer that is composed of a small and large subunit. PRIM1 is 420 amino acids long and approximately 49kDa. The DNA Primase small subunit synthesizes RNA primers for the Okazaki fragments created during discontinuous DNA replication. Current research surrounding PRIM1 has shown a possible link with carcinomas, malaria, neuronitis, and osteosarcoma. DNA Primase small subunit has also been shown to interact with Histone cluster 1 H4/A, H4/B, H4/C, H4/D and H4/E in pathways such as DNA replication, DNA strand elongation, polymerase switching, and lagging strand synthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP1-88650
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NB100-2176
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
NBP2-58498
Species: Hu
Applications: ICC/IF
AF2849
Species: Mu, Rt
Applications: WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB4364
Species: Rt
Applications: ICC, IHC, IP, KO, WB
AF2699
Species: Mu
Applications: Simple Western, WB
NBP1-87760
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
2428-FC
Species: Hu
Applications: Bind
NBP1-89530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3770
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-92564
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-91931
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
419-ML
Species: Mu
Applications: BA
MAB2014
Species: Hu
Applications: CyTOF-reported, Flow
NBP2-48704
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for DNA Primase small subunit Protein (NBP1-90897PEP) (0)

There are no publications for DNA Primase small subunit Protein (NBP1-90897PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Primase small subunit Protein (NBP1-90897PEP) (0)

There are no reviews for DNA Primase small subunit Protein (NBP1-90897PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNA Primase small subunit Protein (NBP1-90897PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNA Primase small subunit Products

Research Areas for DNA Primase small subunit Protein (NBP1-90897PEP)

Find related products by research area.

Blogs on DNA Primase small subunit

There are no specific blogs for DNA Primase small subunit, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNA Primase small subunit Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRIM1