Recombinant Human DNA Polymerase epsilon catalytic subunit A Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human DNA Polymerase epsilon catalytic subunit A Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 370 of Human POLE full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDPSNYGGIKGKVSSRIHCGLQDSQKAGGAEDEQENEDDEEERDGEEEEEAEESNVEDLLENNWNILQFLPQAASCQNYFLMIVSAYIVAVYHCMKDGLRRSAPGSTPVRRRGASQLSQEAEGAVGALPGMITFSQDYVANELTQSFFTITQKIQKKVTGSRNSTELSEMFPVLPGSHLLLNNPALEFIKYVCKVLSLDTNITNQVNKLNRDLLRLVDVGEFSEEAQFRDPCRSYVLPEVICRSCNFCRDLDLCKDSSFSEDGAVLPQWLCSNCQAPYDSSAIEMTLVEVLQKKLVAFTLQDLVCLKCRGVKETSMPVYCSCAGDFALTIHTQVFMEQIGIFRNIAQHYGMSYLLETLEWLLQKNPQLGH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
POLE
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
66.44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DNA Polymerase epsilon catalytic subunit A Protein

  • DKFZp434F222
  • DNA polymerase epsilon catalytic subunit A
  • DNA polymerase II subunit A
  • EC 2.7.7
  • EC 2.7.7.7
  • POLE1FLJ21434
  • polymerase (DNA directed), epsilon

Background

POLE( AAH21559, 1 a.a. - 371 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57595
Species: Hu
Applications: ICC/IF
NB100-74611
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-64870
Species: Hu
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-16391
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-65263
Species: Hu
NB100-56356
Species: Hu
Applications: WB
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBL1-15012
Species: Hu
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-83430
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-61070
Species: Hu
Applications: WB (-), IP
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
H00005426-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for DNA Polymerase epsilon catalytic subunit A Recombinant Protein (H00005426-P01) (0)

There are no publications for DNA Polymerase epsilon catalytic subunit A Recombinant Protein (H00005426-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Polymerase epsilon catalytic subunit A Recombinant Protein (H00005426-P01) (0)

There are no reviews for DNA Polymerase epsilon catalytic subunit A Recombinant Protein (H00005426-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNA Polymerase epsilon catalytic subunit A Recombinant Protein (H00005426-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNA Polymerase epsilon catalytic subunit A Products

Bioinformatics Tool for DNA Polymerase epsilon catalytic subunit A Recombinant Protein (H00005426-P01)

Discover related pathways, diseases and genes to DNA Polymerase epsilon catalytic subunit A Recombinant Protein (H00005426-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA Polymerase epsilon catalytic subunit A Recombinant Protein (H00005426-P01)

Discover more about diseases related to DNA Polymerase epsilon catalytic subunit A Recombinant Protein (H00005426-P01).
 

Pathways for DNA Polymerase epsilon catalytic subunit A Recombinant Protein (H00005426-P01)

View related products by pathway.

PTMs for DNA Polymerase epsilon catalytic subunit A Recombinant Protein (H00005426-P01)

Learn more about PTMs related to DNA Polymerase epsilon catalytic subunit A Recombinant Protein (H00005426-P01).
 

Research Areas for DNA Polymerase epsilon catalytic subunit A Recombinant Protein (H00005426-P01)

Find related products by research area.

Blogs on DNA Polymerase epsilon catalytic subunit A

There are no specific blogs for DNA Polymerase epsilon catalytic subunit A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DNA Polymerase epsilon catalytic subunit A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POLE