DNA Polymerase beta Recombinant Protein Antigen

Images

 
There are currently no images for DNA Polymerase beta Protein (NBP2-38600PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DNA Polymerase beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLB.

Source: E.coli

Amino Acid Sequence: YCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POLB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38600.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for DNA Polymerase beta Recombinant Protein Antigen

  • DNA pol beta
  • DNA polymerase beta subunit
  • DNA Polymerase beta
  • EC 2.7.7.7
  • EC 4.2.99.-
  • MGC125976
  • POLB
  • polymerase (DNA directed), beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-81665
Species: Hu, Mu
Applications: WB (-), IHC, IHC-P, IP
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-87154
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-56356
Species: Hu
Applications: WB
NB100-106
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-41190
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IP, PLA, B/N
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57664
Species: Hu
Applications: WB, ICC/IF
NB100-119
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-38600PEP
Species: Hu
Applications: AC

Publications for DNA Polymerase beta Protein (NBP2-38600PEP) (0)

There are no publications for DNA Polymerase beta Protein (NBP2-38600PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Polymerase beta Protein (NBP2-38600PEP) (0)

There are no reviews for DNA Polymerase beta Protein (NBP2-38600PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for DNA Polymerase beta Protein (NBP2-38600PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for DNA Polymerase beta Protein (NBP2-38600PEP)

Discover related pathways, diseases and genes to DNA Polymerase beta Protein (NBP2-38600PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA Polymerase beta Protein (NBP2-38600PEP)

Discover more about diseases related to DNA Polymerase beta Protein (NBP2-38600PEP).
 

Pathways for DNA Polymerase beta Protein (NBP2-38600PEP)

View related products by pathway.

PTMs for DNA Polymerase beta Protein (NBP2-38600PEP)

Learn more about PTMs related to DNA Polymerase beta Protein (NBP2-38600PEP).
 

Research Areas for DNA Polymerase beta Protein (NBP2-38600PEP)

Find related products by research area.

Blogs on DNA Polymerase beta.

PARP Antibody Assays aid both Apoptosis and Cancer Research
The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play...  Read full blog post.

Customers Who Bought This Also Bought

OGG1 Antibody
NB100-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNA Polymerase beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POLB