DNA-PKcs Antibody (2A8)

Images

 
Western Blot: DNA-PKcs Antibody (2A8) [H00005591-M03] - Analysis of PRKDC expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/ Immunofluorescence: DNA-PKcs Antibody (2A8) [H00005591-M03] - Analysis of monoclonal antibody to PRKDC on HeLa cell. Antibody concentration 40 ug/ml
Immunohistochemistry-Paraffin: DNA-PKcs Antibody (2A8) [H00005591-M03] - Analysis of monoclonal antibody to PRKDC on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml
Sandwich ELISA: DNA-PKcs Antibody (2A8) [H00005591-M03] - Detection limit for recombinant GST tagged PRKDC is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DNA-PKcs Antibody (2A8) Summary

Immunogen
PRKDC (NP_008835 4019 a.a. - 4128 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGREPWM
Specificity
PRKDC (2A8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRKDC
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for ELISA and IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNA-PKcs Antibody (2A8)

  • DNA-dependent protein kinase catalytic subunit-like
  • DNA-dependent protein kinase
  • DNA-PK catalytic subunit
  • DNAPK
  • DNAPKcs
  • DNA-PKcs
  • DNPK1
  • EC 2.7.11.1
  • HYRC
  • HYRC1
  • p350
  • p460
  • PRKDC
  • XRCC7

Background

The PRKDC gene encodes the catalytic subunit of a nuclear DNA-dependent serine/threonine protein kinase (DNA-PK). The second component is the autoimmune antigen Ku (MIM 152690), which is encoded by the G22P1 gene on chromosome 22q. On its own, the catalytic subunit of DNA-PK is inactive and relies on the G22P1 component to direct it to the DNA and trigger its kinase activity; PRKDC must be bound to DNA to express its catalytic properties.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-56408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-1915
Species: Hu, Mu, Rt, Ha, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89463
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-183
Species: Hu
Applications: WB
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
AF1626
Species: Hu
Applications: WB, ICC
H00005591-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for DNA-PKcs Antibody (H00005591-M03) (0)

There are no publications for DNA-PKcs Antibody (H00005591-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA-PKcs Antibody (H00005591-M03) (0)

There are no reviews for DNA-PKcs Antibody (H00005591-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNA-PKcs Antibody (H00005591-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DNA-PKcs Antibody (H00005591-M03)

Discover related pathways, diseases and genes to DNA-PKcs Antibody (H00005591-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA-PKcs Antibody (H00005591-M03)

Discover more about diseases related to DNA-PKcs Antibody (H00005591-M03).
 

Pathways for DNA-PKcs Antibody (H00005591-M03)

View related products by pathway.

PTMs for DNA-PKcs Antibody (H00005591-M03)

Learn more about PTMs related to DNA-PKcs Antibody (H00005591-M03).
 

Research Areas for DNA-PKcs Antibody (H00005591-M03)

Find related products by research area.

Blogs on DNA-PKcs

There are no specific blogs for DNA-PKcs, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA-PKcs Antibody (2A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKDC
Entrez
OMIM
Uniprot