DNA Ligase IV Antibody (2D2)

Images

 
Sandwich ELISA: DNA Ligase IV Antibody (2D2) [H00003981-M02] - Detection limit for recombinant GST tagged LIG4 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DNA Ligase IV Antibody (2D2) Summary

Immunogen
LIG4 (AAH37491 802 a.a. - 911 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAIKALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKILKESWVTDSIDKCELQEENQYLI
Specificity
LIG4 - ligase IV, DNA, ATP-dependent (2D2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LIG4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNA Ligase IV Antibody (2D2)

  • DNA joinase
  • DNA ligase 4
  • DNA ligase IV
  • DNA repair enzyme
  • EC 6.5.1.1
  • ligase IV, DNA, ATP-dependent
  • Polydeoxyribonucleotide synthase [ATP] 4
  • polynucleotide ligase
  • sealase

Background

The protein encoded by this gene is a DNA ligase that joins single-strand breaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. This protein is essential for V(D)J recombination and DNA double-strand break (DSB) repair through nonhomologous end joining (NHEJ). This protein forms a complex with the X-ray repair cross complementing protein 4 (XRCC4), and further interacts with the DNA-dependent protein kinase (DNA-PK). Both XRCC4 and DNA-PK are known to be required for NHEJ. The crystal structure of the complex formed by this protein and XRCC4 has been resolved. Defects in this gene are the cause of LIG4 syndrome. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP1-48053
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-106
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-1915
Species: Hu, Mu, Rt, Ha, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NB100-183
Species: Hu
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-03275
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
H00003981-M02
Species: Hu
Applications: WB, ELISA

Publications for DNA Ligase IV Antibody (H00003981-M02) (0)

There are no publications for DNA Ligase IV Antibody (H00003981-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Ligase IV Antibody (H00003981-M02) (0)

There are no reviews for DNA Ligase IV Antibody (H00003981-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNA Ligase IV Antibody (H00003981-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNA Ligase IV Products

Bioinformatics Tool for DNA Ligase IV Antibody (H00003981-M02)

Discover related pathways, diseases and genes to DNA Ligase IV Antibody (H00003981-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA Ligase IV Antibody (H00003981-M02)

Discover more about diseases related to DNA Ligase IV Antibody (H00003981-M02).
 

Pathways for DNA Ligase IV Antibody (H00003981-M02)

View related products by pathway.

PTMs for DNA Ligase IV Antibody (H00003981-M02)

Learn more about PTMs related to DNA Ligase IV Antibody (H00003981-M02).
 

Research Areas for DNA Ligase IV Antibody (H00003981-M02)

Find related products by research area.

Blogs on DNA Ligase IV

There are no specific blogs for DNA Ligase IV, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA Ligase IV Antibody (2D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol LIG4
Entrez
Uniprot