DMTF1 Recombinant Protein Antigen

Images

 
There are currently no images for DMTF1 Protein (NBP1-84073PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DMTF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DMTF1.

Source: E. coli

Amino Acid Sequence: ASPTVTLTAAAPASPEQIIVHALSPEHLLNTSDNVTVQCHTPRVIIQTVATEDITSSISQAELTVDSDIQSSDFPEPPDALEADTFPDEIHHPKMTVEPSFNDAHVSKFSDQNSTELMNSVMVRTEEEI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DMTF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84073.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DMTF1 Recombinant Protein Antigen

  • cyclin D binding myb-like transcription factor 1
  • cyclin D-binding Myb-like protein 1
  • cyclin-D-binding Myb-like transcription factor 1
  • Cyclin-D-interacting Myb-like protein 1
  • DMP1FLJ76054
  • FLJ25188
  • FLJ41265
  • hDMP1DMTF
  • hDMTF1

Background

DMTF1 encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92546
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
4014-SP
Species: Hu
Applications: BA
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
MAB26291
Species: Mu
Applications: IHC
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
8090-ZN
Species: Hu
Applications: EnzAct
AF6150
Species: Mu
Applications: WB
MAB7665
Species: Hu
Applications: IHC, WB
NBP3-27690
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
DPI00
Species: Hu
Applications: ELISA
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
NBP2-92749
Species: Hu, Mu
Applications: ELISA, WB
NBP3-15742
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-84073PEP
Species: Hu
Applications: AC

Publications for DMTF1 Protein (NBP1-84073PEP) (0)

There are no publications for DMTF1 Protein (NBP1-84073PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DMTF1 Protein (NBP1-84073PEP) (0)

There are no reviews for DMTF1 Protein (NBP1-84073PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DMTF1 Protein (NBP1-84073PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DMTF1 Products

Array NBP1-84073PEP

Research Areas for DMTF1 Protein (NBP1-84073PEP)

Find related products by research area.

Blogs on DMTF1

There are no specific blogs for DMTF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DMTF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DMTF1