We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DLX5 Recombinant Protein Antigen

Images

 
There are currently no images for DLX5 Protein (NBP1-85793PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DLX5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DLX5.

Source: E. coli

Amino Acid Sequence: RRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DLX5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85793.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DLX5 Recombinant Protein Antigen

  • distal-less homeo box 5
  • distal-less homeobox 5
  • DLX5
  • homeobox protein DLX-5

Background

Dlx5 (distal-less homeobox 5) gene is a member of a homeobox gene family similiar to the Drosophila distal-less gene. The encoded Dlx5 protein is localized to the nucleus where it functions as a transcriptional regulator during neural development. In the developing CNS, Dlx5 is one of the earliest known markers before the formation of an overt neural plate. During late gastrulation Dlx5 (gene) expression becomes localized to the anterior neural ridge, which defines the rostral boundary of the neural plate, and also extends caudolaterally, marking the region of the presumptive neural crest. Subsequently, Dlx5 is expressed in tissues (olfactory epithelium, ventral cephalic epithelium) that are believed to derive from the anterior neural ridge.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

355-BM
Species: Hu, Mu, Rt
Applications: BA
NBP1-85929
Species: Hu
Applications: IHC,  IHC-P
MAB7547
Species: Hu
Applications: ICC, WB
NBP1-85445
Species: Hu
Applications: IHC,  IHC-P
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
4014-SP
Species: Hu
Applications: BA
H00001746-M01
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
314-BP
Species: Hu
Applications: BA, BA
DPI00
Species: Hu
Applications: ELISA
NB100-56326
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
NBP2-92749
Species: Hu, Mu
Applications: ELISA, WB
NBP3-15742
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
H00001745-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP1-85793PEP
Species: Hu
Applications: AC

Publications for DLX5 Protein (NBP1-85793PEP) (0)

There are no publications for DLX5 Protein (NBP1-85793PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DLX5 Protein (NBP1-85793PEP) (0)

There are no reviews for DLX5 Protein (NBP1-85793PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DLX5 Protein (NBP1-85793PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DLX5 Products

Research Areas for DLX5 Protein (NBP1-85793PEP)

Find related products by research area.

Blogs on DLX5

There are no specific blogs for DLX5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DLX5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DLX5