DLG1 Antibody (1B12) - Azide and BSA Free

Western Blot: DLG1 Antibody (1B12) [H00001739-M03] - Detection against Immunogen (35.64 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1B12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DLG1 Antibody (1B12) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: DLG1 (NP_004078, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
• Specificity: DLG1 - discs, large homolog 1 (Drosophila) (1B12)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DLG1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DLG1 Antibody (1B12) - Azide and BSA Free

• discs, large homolog 1 (Drosophila)
• disks large homolog 1
• DKFZp761P0818
• DKFZp781B0426
• hDlg
• large (Drosophila) homolog 1
• presynaptic protein SAP97

Background

DLG1(disks large homolog 1), also known as SAP97(synapse-associated protein 97), is a scaffolding protein that contains three PDZ domains, one SH3 domain, one L27 domain, and one guanylate kinase-like domain. DLG1has been found to control ion channel clustering at post-synaptic densities in neural cells and to also play a role in adherens junction assembly, and the recruitment of signaling molecules to discreet plasma membrane domains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DLG1
• Entrez:
  • 1739(Human)
• Uniprot:
  • NP_004078(Human)