Dkk-4 Recombinant Protein Antigen

Images

 
There are currently no images for Dkk-4 Protein (NBP2-47484PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Dkk-4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DKK4.

Source: E.coli

Amino Acid Sequence: PILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARH

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DKK4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-47484.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Dkk-4 Recombinant Protein Antigen

  • dickkopf (Xenopus laevis) homolog 4
  • dickkopf homolog 4 (Xenopus laevis)
  • dickkopf-4
  • dickkopf-related protein 4
  • Dkk4
  • Dkk-4
  • hDkk-4
  • MGC129562
  • MGC129563

Background

DKK4 is a secreted protein that is a member of the dickkopf family. Like some other members of the dickkopf family DKK4 contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The activity of DKK4 is modulated by binding to the Wnt co-receptor and the co-factor kremen 2, and it is proposed that it is also an inhibitor of the Wnt signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

5439-DK/CF
Species: Hu
Applications: BA
AF2435
Species: Mu
Applications: IHC, WB
AF1118
Species: Hu
Applications: IHC, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00001594-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
5396-SF
Species: Hu
Applications: BA
PP-H4537-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
1827-SF/CF
Species: Hu
Applications: BA
1341-WF/CF
Species: Hu
Applications: BA
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00006925-M03
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
1169-FR/CF
Species: Mu
Applications: Bind

Publications for Dkk-4 Protein (NBP2-47484PEP) (0)

There are no publications for Dkk-4 Protein (NBP2-47484PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dkk-4 Protein (NBP2-47484PEP) (0)

There are no reviews for Dkk-4 Protein (NBP2-47484PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dkk-4 Protein (NBP2-47484PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dkk-4 Products

Bioinformatics Tool for Dkk-4 Protein (NBP2-47484PEP)

Discover related pathways, diseases and genes to Dkk-4 Protein (NBP2-47484PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dkk-4 Protein (NBP2-47484PEP)

Discover more about diseases related to Dkk-4 Protein (NBP2-47484PEP).
 

Pathways for Dkk-4 Protein (NBP2-47484PEP)

View related products by pathway.

PTMs for Dkk-4 Protein (NBP2-47484PEP)

Learn more about PTMs related to Dkk-4 Protein (NBP2-47484PEP).
 

Research Areas for Dkk-4 Protein (NBP2-47484PEP)

Find related products by research area.

Blogs on Dkk-4

There are no specific blogs for Dkk-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dkk-4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DKK4