Recombinant Human DIRAS3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human DIRAS3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 130-229 of Human DIRAS3

Source: Wheat Germ

Amino Acid Sequence: FYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
DIRAS3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DIRAS3 Protein

  • DIRAS family, GTP-binding RAS-like 3
  • Distinct subgroup of the Ras family member 3
  • NOEY2member I
  • RHOI
  • Rho-related GTP-binding protein RhoI

Background

DIRAS3 - DIRAS family, GTP-binding RAS-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NBP2-24695
Species: Hu
Applications: WB, IHC-P
NBP2-66154
Species: Hu
MAB1799
Species: Hu, Mu, Rt
Applications: WB, IP, ICC, ICFlow, KO
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37474
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-47624
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21374
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
H00009077-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for DIRAS3 Partial Recombinant Protein (H00009077-Q01) (0)

There are no publications for DIRAS3 Partial Recombinant Protein (H00009077-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIRAS3 Partial Recombinant Protein (H00009077-Q01) (0)

There are no reviews for DIRAS3 Partial Recombinant Protein (H00009077-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DIRAS3 Partial Recombinant Protein (H00009077-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for DIRAS3 Partial Recombinant Protein (H00009077-Q01)

Discover related pathways, diseases and genes to DIRAS3 Partial Recombinant Protein (H00009077-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIRAS3 Partial Recombinant Protein (H00009077-Q01)

Discover more about diseases related to DIRAS3 Partial Recombinant Protein (H00009077-Q01).
 

Pathways for DIRAS3 Partial Recombinant Protein (H00009077-Q01)

View related products by pathway.

PTMs for DIRAS3 Partial Recombinant Protein (H00009077-Q01)

Learn more about PTMs related to DIRAS3 Partial Recombinant Protein (H00009077-Q01).
 

Research Areas for DIRAS3 Partial Recombinant Protein (H00009077-Q01)

Find related products by research area.

Blogs on DIRAS3.

ULK1 - mammalian homologue of the yeast ATG1 kinase
Autophagy is an important cellular process involved in degradation and recycling of cellular macromolecules in response to stress or starvation. Autophagy is carried out in four main phases: phagophore nucleation, autophagosome elongation, docking...  Read full blog post.

Customers Who Bought This Also Bought

DIRAS3 Antibody
NBP1-90105

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DIRAS3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DIRAS3