Recombinant Human DIRAS3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DIRAS3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 130-229 of Human DIRAS3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DIRAS3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DIRAS3 Protein

  • DIRAS family, GTP-binding RAS-like 3
  • Distinct subgroup of the Ras family member 3
  • NOEY2member I
  • RHOI
  • Rho-related GTP-binding protein RhoI

Background

DIRAS3 - DIRAS family, GTP-binding RAS-like 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
H00056996-R01
Species: Hu
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-47624
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21374
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
H00009077-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for DIRAS3 Partial Recombinant Protein (H00009077-Q01) (0)

There are no publications for DIRAS3 Partial Recombinant Protein (H00009077-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIRAS3 Partial Recombinant Protein (H00009077-Q01) (0)

There are no reviews for DIRAS3 Partial Recombinant Protein (H00009077-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DIRAS3 Partial Recombinant Protein (H00009077-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DIRAS3 Products

Bioinformatics Tool for DIRAS3 Partial Recombinant Protein (H00009077-Q01)

Discover related pathways, diseases and genes to DIRAS3 Partial Recombinant Protein (H00009077-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIRAS3 Partial Recombinant Protein (H00009077-Q01)

Discover more about diseases related to DIRAS3 Partial Recombinant Protein (H00009077-Q01).
 

Pathways for DIRAS3 Partial Recombinant Protein (H00009077-Q01)

View related products by pathway.

PTMs for DIRAS3 Partial Recombinant Protein (H00009077-Q01)

Learn more about PTMs related to DIRAS3 Partial Recombinant Protein (H00009077-Q01).
 

Research Areas for DIRAS3 Partial Recombinant Protein (H00009077-Q01)

Find related products by research area.

Blogs on DIRAS3.

ULK1 - mammalian homologue of the yeast ATG1 kinase
Autophagy is an important cellular process involved in degradation and recycling of cellular macromolecules in response to stress or starvation. Autophagy is carried out in four main phases: phagophore nucleation, autophagosome elongation, docking...  Read full blog post.

Customers Who Bought This Also Bought

DIRAS3 Antibody
NBP1-90105

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DIRAS3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DIRAS3