Recombinant Human DIP13B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DIP13B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 174-273 of Human APPL2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QHLSSLQYYCALNALQYRKQMAMMEPMIGFAHGQINFFKKGAEMFSKRMDSFLSSVADMVQSIQVELEAEAEKMRVSQQELLSVDESVYTPDSDVAAPQI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
APPL2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DIP13B Protein

  • Adapter protein containing PH domain, PTB domain and leucine zipper motif 2
  • adaptor protein containing PH domain, PTB domain and leucine zipper motif 2
  • adaptor protein, phosphotyrosine interaction, PH domain and leucine zippercontaining 2
  • DCC-interacting protein 13-beta
  • DIP13BDIP13 beta
  • Dip13-beta
  • FLJ10659dip13-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7075
Species: Hu
Applications: WB
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-28641
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC, IHC-P
NBP1-28640
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB400-153
Species: Hu
Applications: WB, ICC/IF
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-40354
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC

Publications for DIP13B Partial Recombinant Protein (H00055198-Q01) (0)

There are no publications for DIP13B Partial Recombinant Protein (H00055198-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIP13B Partial Recombinant Protein (H00055198-Q01) (0)

There are no reviews for DIP13B Partial Recombinant Protein (H00055198-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DIP13B Partial Recombinant Protein (H00055198-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DIP13B Products

Bioinformatics Tool for DIP13B Partial Recombinant Protein (H00055198-Q01)

Discover related pathways, diseases and genes to DIP13B Partial Recombinant Protein (H00055198-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIP13B Partial Recombinant Protein (H00055198-Q01)

Discover more about diseases related to DIP13B Partial Recombinant Protein (H00055198-Q01).
 

Pathways for DIP13B Partial Recombinant Protein (H00055198-Q01)

View related products by pathway.

PTMs for DIP13B Partial Recombinant Protein (H00055198-Q01)

Learn more about PTMs related to DIP13B Partial Recombinant Protein (H00055198-Q01).

Blogs on DIP13B

There are no specific blogs for DIP13B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HDAC1 Antibody
NB100-56340
DIP13B Antibody
H00055198-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DIP13B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APPL2