DIAPH3 Antibody [HRP] Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 630-849 of human DIAPH3 (NP_112194.2).
Sequence: KYPDILNFVDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLLEMKTEGDETGVMDNLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQRPVLKVCNHGNKPYL |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
DIAPH3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
PBS |
Preservative |
No Preservative |
Purity |
Affinity purified |
Alternate Names for DIAPH3 Antibody [HRP]
Background
DIAPH3 binds to GTP-bound form of Rho and to profilin. Acts in a Rho-dependent manner to recruit profilin to themembrane, where it promotes actin polymerization. It is required for cytokinesis, stress fiber formation, andtranscriptional activation of the serum r
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Mu
Applications: IHC, WB
Species: Ca, Eq, Hu, Mu, Pm, Rt, RM
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Pm
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu, Mu, Rt
Applications: ELISA, IP, PLA, WB
Publications for DIAPH3 Antibody (NBP3-35125H) (0)
There are no publications for DIAPH3 Antibody (NBP3-35125H).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DIAPH3 Antibody (NBP3-35125H) (0)
There are no reviews for DIAPH3 Antibody (NBP3-35125H).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DIAPH3 Antibody (NBP3-35125H) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DIAPH3 Products
Research Areas for DIAPH3 Antibody (NBP3-35125H)
Find related products by research area.
|
Blogs on DIAPH3