DIAPH3 Antibody [mFluor Violet 450 SE]

Product Discontinued

DIAPH3 Antibody [mFluor Violet 450 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 630-849 of human DIAPH3 (NP_112194.2).
  
  Sequence:
  KYPDILNFVDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLLEMKTEGDETGVMDNLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQRPVLKVCNHGNKPYL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DIAPH3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for DIAPH3 Antibody [mFluor Violet 450 SE]

• DIAP3
• diaphanous homolog 3 (Drosophila)
• diaphanous-related formin 3
• DKFZp434C0931
• DKFZp686A13178
• homolog) 3
• mDia2
• protein diaphanous homolog 3

Background

DIAPH3 binds to GTP-bound form of Rho and to profilin. Acts in a Rho-dependent manner to recruit profilin to themembrane, where it promotes actin polymerization. It is required for cytokinesis, stress fiber formation, andtranscriptional activation of the serum r

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DIAPH3