DHX8 Antibody (1E10.)

Images

 
Western Blot: DHX8 Antibody (1E10) [H00001659-M01] - DHX8 monoclonal antibody (M01), clone 1E10 Analysis of DHX8 expression in Hela S3 NE.
Sandwich ELISA: DHX8 Antibody (1E10) [H00001659-M01] - Detection limit for recombinant GST tagged DHX8 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DHX8 Antibody (1E10.) Summary

Immunogen
DHX8 (NP_004932 301 a.a. - 400 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW
Specificity
DHX8 (1E10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DHX8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DHX8 Antibody (1E10.)

  • DDX8ATP-dependent RNA helicase DHX8
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 8 (RNA helicase)
  • DEAH (Asp-Glu-Ala-His) box polypeptide 8
  • DEAH box protein 8
  • DEAH-box protein 8
  • EC 3.6.1
  • EC 3.6.4.13
  • HRH1RNA helicase HRH1
  • PRP22
  • PRPF22

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is highly homologous to yeast Prp22. This protein facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80876
Species: Hu
Applications: WB, IHC, IHC-P
NB100-586
Species: Hu
Applications: WB, IP
NB600-812
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-58541
Species: Hu
Applications: ICC/IF
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NLS476
Species: Hu, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP1-92297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00079092-T01
Species: Hu
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
AF7637
Species: Hu
Applications: WB
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-58978
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb, Sh
Applications: ELISA, IHC-P
AF5745
Species: Hu
Applications: WB, IHC

Publications for DHX8 Antibody (H00001659-M01) (0)

There are no publications for DHX8 Antibody (H00001659-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHX8 Antibody (H00001659-M01) (0)

There are no reviews for DHX8 Antibody (H00001659-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHX8 Antibody (H00001659-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DHX8 Products

Bioinformatics Tool for DHX8 Antibody (H00001659-M01)

Discover related pathways, diseases and genes to DHX8 Antibody (H00001659-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHX8 Antibody (H00001659-M01)

Discover more about diseases related to DHX8 Antibody (H00001659-M01).
 

Pathways for DHX8 Antibody (H00001659-M01)

View related products by pathway.

Blogs on DHX8

There are no specific blogs for DHX8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHX8 Antibody (1E10.) and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX8
Entrez
OMIM
Uniprot