DHX34 Antibody

Images

 
Western Blot: DHX34 Antibody [NBP2-87271] - WB Suggested Anti-DHX34 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: THP-1 cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DHX34 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DHX34. Peptide sequence: APQDGPPGAEEAALETLQKTSVLQRPYHCEACGKDFLFTPTEVLRHRKQH The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
DHX34
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DHX34 Antibody

  • DDX34
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 34
  • DEAH (Asp-Glu-Ala-His) box polypeptide 34
  • DEAH box protein 34
  • HRH1
  • KIAA0134

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86082
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-13919
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-16202
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP1-89495
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-19444
Species: Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
NBP2-13923
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF4737
Species: Hu
Applications: WB
NBP2-16800
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-88996
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
H00004340-B01P
Species: Hu, Rt
Applications: WB
AF482
Species: Mu
Applications: IHC, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-46328
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB38951
Species: Hu
Applications: IHC

Publications for DHX34 Antibody (NBP2-87271) (0)

There are no publications for DHX34 Antibody (NBP2-87271).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHX34 Antibody (NBP2-87271) (0)

There are no reviews for DHX34 Antibody (NBP2-87271). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHX34 Antibody (NBP2-87271) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DHX34 Products

Array NBP2-87271

Bioinformatics Tool for DHX34 Antibody (NBP2-87271)

Discover related pathways, diseases and genes to DHX34 Antibody (NBP2-87271). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DHX34

There are no specific blogs for DHX34, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHX34 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX34