Recombinant Human DHX16 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DHX16 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 940-1041 of Human DHX16 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RKAITAGYFYHTARLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELEDPHAKKMPKKIGKTREELG

Protein/Peptide Type
Partial Recombinant Protein
Gene
DHX16

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DHX16 Protein

  • ATP-dependent RNA helicase #3
  • DBP2PRO2014
  • DDX16DEAD/H box 16
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 16
  • DEAH (Asp-Glu-Ala-His) box polypeptide 16
  • DEAH-box protein 16
  • EC 3.6.1
  • EC 3.6.4.13
  • KIAA0577
  • Prp2
  • PRP8
  • PRPF2
  • putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16
  • RNA helicase

Background

DHX16 - DEAH (Asp-Glu-Ala-His) box polypeptide 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-1713
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-90086
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58541
Species: Hu
Applications: ICC/IF
NBP1-83219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00079092-T01
Species: Hu
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-92692
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-586
Species: Hu
Applications: WB, IP
NBP1-31354
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP1-87019
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82510
Species: Hu
Applications: WB, IHC, IHC-P
H00008449-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for DHX16 Partial Recombinant Protein (H00008449-Q01) (0)

There are no publications for DHX16 Partial Recombinant Protein (H00008449-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHX16 Partial Recombinant Protein (H00008449-Q01) (0)

There are no reviews for DHX16 Partial Recombinant Protein (H00008449-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHX16 Partial Recombinant Protein (H00008449-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DHX16 Products

Bioinformatics Tool for DHX16 Partial Recombinant Protein (H00008449-Q01)

Discover related pathways, diseases and genes to DHX16 Partial Recombinant Protein (H00008449-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for DHX16 Partial Recombinant Protein (H00008449-Q01)

View related products by pathway.

Research Areas for DHX16 Partial Recombinant Protein (H00008449-Q01)

Find related products by research area.

Blogs on DHX16

There are no specific blogs for DHX16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DHX16 Antibody
NBP2-13920
SLU7 Antibody
NBP2-20403

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DHX16 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX16