DGK-epsilon Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DGK-epsilon Antibody [NBP1-85315] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: DGK-epsilon Antibody [NBP1-85315] - Staining of human testis shows distinct positivity in spermatids and spermatozoa.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DGK-epsilon Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFGEFKNLIIPPSYL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DGKE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DGK-epsilon Protein (NBP1-85315PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DGK-epsilon Antibody

  • DAG kinase epsilon
  • DAGK5
  • DAGK6
  • DGK
  • DGKE
  • DGKepsilon
  • DGK-epsilon
  • diacylglycerol kinase epsilon
  • diacylglycerol kinase, epsilon (64kD)
  • diacylglycerol kinase, epsilon 64kDa
  • Diglyceride kinase epsilon
  • EC 2.7.1.107

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84256
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-20626
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92505
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13918
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01597
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB7426
Species: Hu
Applications: WB
AF2364
Species: Hu
Applications: WB, IHC
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA

Publications for DGK-epsilon Antibody (NBP1-85315) (0)

There are no publications for DGK-epsilon Antibody (NBP1-85315).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DGK-epsilon Antibody (NBP1-85315) (0)

There are no reviews for DGK-epsilon Antibody (NBP1-85315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DGK-epsilon Antibody (NBP1-85315) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DGK-epsilon Products

Bioinformatics Tool for DGK-epsilon Antibody (NBP1-85315)

Discover related pathways, diseases and genes to DGK-epsilon Antibody (NBP1-85315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DGK-epsilon Antibody (NBP1-85315)

Discover more about diseases related to DGK-epsilon Antibody (NBP1-85315).
 

Pathways for DGK-epsilon Antibody (NBP1-85315)

View related products by pathway.

Research Areas for DGK-epsilon Antibody (NBP1-85315)

Find related products by research area.

Blogs on DGK-epsilon

There are no specific blogs for DGK-epsilon, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DGK-epsilon Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DGKE
Entrez