DGCR14 Antibody

Western Blot: DGCR14 Antibody [NBP1-84258] - Analysis in control (vector only transfected HEK293T lysate) and DGCR14 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: DGCR14 Antibody [NBP1-84258] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DGCR14 Antibody [NBP1-84258] - Staining of human cerebral cortex, colon, liver and testis using Anti-DGCR14 antibody NBP1-84258 (A) shows similar protein distribution across tissues to independent antibody NBP1-84257 (B).

Immunohistochemistry-Paraffin: DGCR14 Antibody [NBP1-84258] - Staining of human colon using Anti-DGCR14 antibody.

Immunohistochemistry-Paraffin: DGCR14 Antibody [NBP1-84258] - Staining of human liver using Anti-DGCR14 antibody.

Immunohistochemistry-Paraffin: DGCR14 Antibody [NBP1-84258] - Staining of human cerebral cortex using Anti-DGCR14 antibody.

Immunohistochemistry-Paraffin: DGCR14 Antibody [NBP1-84258] - Staining of human testis using Anti-DGCR14 antibody.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DGCR14 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ASASSLLLPAASRPPRKREAGEAGAATSKQRVLDEEEYIEGLQTVIQRDFFPDVEKLQAQKEYLEAEENGDLERMRQIAIKFGSALGKMSREPPPPYVTPATFETPEVHAGTGVVGNKPRPRGRGLEDGEAGEEEEKEPLPSLDV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ESS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DGCR14 Protein (NBP1-84258PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DGCR14 Antibody

• DGCR13
• DGS-HDGS-I
• DGSIDGSH
• DiGeorge syndrome critical region 13
• DiGeorge syndrome critical region 14
• DiGeorge syndrome critical region gene 13
• DiGeorge syndrome critical region gene 14
• DiGeorge syndrome gene H
• DiGeorge syndrome gene I
• DiGeorge syndrome protein H
• ES2DiGeorge syndrome critical region gene DGSI
• Es2el
• Protein DGCR13
• protein DGCR14
• Protein ES2

Background

DGCR14, also known as DiGeorge syndrome critical region 14, is a 52.6 kDa, 476 amino acid protein that exists in the region thought to be responsible for multiple developmental disorders. Current research is studying the involvement of the protein in diseases and disorders such as DiGeorge syndrome, schizophrenia, velocardiofacial syndrome, and faces syndrome. The protein may be involved in mRNA splicing pathways where it interacts with PFDN1, VIM, TTC14, GNB2L1, and FRA10AC1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ESS2