DGCR14 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ASASSLLLPAASRPPRKREAGEAGAATSKQRVLDEEEYIEGLQTVIQRDFFPDVEKLQAQKEYLEAEENGDLERMRQIAIKFGSALGKMSREPPPPYVTPATFETPEVHAGTGVVGNKPRPRGRGLEDGEAGEEEEKEPLPSLDV |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ESS2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for DGCR14 Antibody
Background
DGCR14, also known as DiGeorge syndrome critical region 14, is a 52.6 kDa, 476 amino acid protein that exists in the region thought to be responsible for multiple developmental disorders. Current research is studying the involvement of the protein in diseases and disorders such as DiGeorge syndrome, schizophrenia, velocardiofacial syndrome, and faces syndrome. The protein may be involved in mRNA splicing pathways where it interacts with PFDN1, VIM, TTC14, GNB2L1, and FRA10AC1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Publications for DGCR14 Antibody (NBP1-84258) (0)
There are no publications for DGCR14 Antibody (NBP1-84258).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DGCR14 Antibody (NBP1-84258) (0)
There are no reviews for DGCR14 Antibody (NBP1-84258).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DGCR14 Antibody (NBP1-84258) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DGCR14 Products
Bioinformatics Tool for DGCR14 Antibody (NBP1-84258)
Discover related pathways, diseases and genes to DGCR14 Antibody (NBP1-84258). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for DGCR14 Antibody (NBP1-84258)
Discover more about diseases related to DGCR14 Antibody (NBP1-84258).
| | Pathways for DGCR14 Antibody (NBP1-84258)
View related products by pathway.
|
Research Areas for DGCR14 Antibody (NBP1-84258)
Find related products by research area.
|
Blogs on DGCR14