GSC2 Antibody

Western Blot: GSC2 Antibody [NBP2-82957] - WB Suggested Anti-GSCL Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysate

Immunohistochemistry: GSC2 Antibody [NBP2-82957] - Human kidney

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GSC2 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GSC2. Peptide sequence: LEALFVQNQYPDVSTRERLAGRIRLREERVEVWFKNRRAKWRHQKRASAS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSC2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Alternate Names for GSC2 Antibody

• goosecoid homeobox 2
• goosecoid-like
• GSC-2
• GSC-L
• GSCLhomeobox protein goosecoid-2
• Homeobox protein goosecoid-like

Background

Goosecoidlike (GSCL), a homeodomain-containing gene, resides in the critical region for VCFS/DGS on 22q11.Velocardiofacial syndrome (VCFS) is a developmental disorder characterized by conotruncal heart defects, craniofacialanomalies, and learning disabilities. VCFS is phenotypically related to DiGeorge syndrome (DGS) and both syndromes areassociated with hemizygous 22q11 deletions. Because many of the tissues and structures affected in VCFS/DGS derivefrom the pharyngeal arches of the developing embryo, it is believed that haploinsufficiency of a gene involved inembryonic development may be responsible for its etiology. The gene is expressed in a limited number of adult tissues,as well as in early human development. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GSC2