DGCR14 Antibody

Images

 
Western Blot: DGCR14 Antibody [NBP1-84257] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431
Immunohistochemistry-Paraffin: DGCR14 Antibody [NBP1-84257] - Staining of human gallbladder shows moderate nuclear positivity in glandular cells.
Western Blot: DGCR14 Antibody [NBP1-84257] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DGCR14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LRVEGSETPYVDRTPGPAFKILEPGRRERLGLKMANEAAAKNRAKKQEALRRVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DGCR14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DGCR14 Protein (NBP1-84257PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DGCR14 Antibody

  • DGCR13
  • DGS-HDGS-I
  • DGSIDGSH
  • DiGeorge syndrome critical region 13
  • DiGeorge syndrome critical region 14
  • DiGeorge syndrome critical region gene 13
  • DiGeorge syndrome critical region gene 14
  • DiGeorge syndrome gene H
  • DiGeorge syndrome gene I
  • DiGeorge syndrome protein H
  • ES2DiGeorge syndrome critical region gene DGSI
  • Es2el
  • Protein DGCR13
  • protein DGCR14
  • Protein ES2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91970
Species: Hu
Applications: IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB110-40561
Species: Hu
Applications: WB, IP
AF8064
Species: Hu
Applications: WB, IHC, ICC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
AF4937
Species: Hu
Applications: WB, IHC
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88677
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DGCR14 Antibody (NBP1-84257) (0)

There are no publications for DGCR14 Antibody (NBP1-84257).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DGCR14 Antibody (NBP1-84257) (0)

There are no reviews for DGCR14 Antibody (NBP1-84257). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DGCR14 Antibody (NBP1-84257) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DGCR14 Products

Bioinformatics Tool for DGCR14 Antibody (NBP1-84257)

Discover related pathways, diseases and genes to DGCR14 Antibody (NBP1-84257). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DGCR14 Antibody (NBP1-84257)

Discover more about diseases related to DGCR14 Antibody (NBP1-84257).
 

Pathways for DGCR14 Antibody (NBP1-84257)

View related products by pathway.

Research Areas for DGCR14 Antibody (NBP1-84257)

Find related products by research area.

Blogs on DGCR14

There are no specific blogs for DGCR14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DGCR14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DGCR14