Dfna5 deafness Antibody

Images

 
Western Blot: Dfna5 deafness Antibody [NBP1-87689] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Dfna5 deafness Antibody [NBP1-87689] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: Dfna5 deafness Antibody [NBP1-87689] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dfna5 deafness Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLFDDELLMVLEPVCDDLVSGLSPTVAVLGELKPRQQQDLVAFLQLVGCSLQGGCPGPEDAGSKQLFMTAYFLVSALAEMPDSAAALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQRLFASADISLERLKSSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DFNA5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Dfna5 deafness Protein (NBP1-87689PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dfna5 deafness Antibody

  • deafness, autosomal dominant 5
  • ICERE1
  • ICERE-1nonsyndromic hearing impairment protein
  • Inversely correlated with estrogen receptor expression 1
  • non-syndromic hearing impairment protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

38160002
Species: Hu
Applications: WB, ELISA
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-12899
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
H00002707-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB110-75015
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-33422
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-230
Species: Hu
Applications: WB
AF5249
Species: Hu
Applications: WB
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
20650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-91926
Species: Hu
Applications: IHC, IHC-P
NBP2-02023
Species: Hu
Applications: WB, ICC/IF
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready

Publications for Dfna5 deafness Antibody (NBP1-87689) (0)

There are no publications for Dfna5 deafness Antibody (NBP1-87689).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dfna5 deafness Antibody (NBP1-87689) (0)

There are no reviews for Dfna5 deafness Antibody (NBP1-87689). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dfna5 deafness Antibody (NBP1-87689) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dfna5 deafness Products

Bioinformatics Tool for Dfna5 deafness Antibody (NBP1-87689)

Discover related pathways, diseases and genes to Dfna5 deafness Antibody (NBP1-87689). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dfna5 deafness Antibody (NBP1-87689)

Discover more about diseases related to Dfna5 deafness Antibody (NBP1-87689).
 

Pathways for Dfna5 deafness Antibody (NBP1-87689)

View related products by pathway.

PTMs for Dfna5 deafness Antibody (NBP1-87689)

Learn more about PTMs related to Dfna5 deafness Antibody (NBP1-87689).

Blogs on Dfna5 deafness

There are no specific blogs for Dfna5 deafness, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dfna5 deafness Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DFNA5