Desmoglein-4 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: DLDTGNPATDVRYIIGHDAGSWLKIDSRTGEIQFSREFDKKSKYIINGIYTAEILAIDDGSGKTATGTICIEVPDINDYCPNIFPERRTICIDSP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DSG4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Desmoglein-4 Antibody - BSA Free
Background
DSG4, also known as Desmoglein-4, consists of a 113.8 kDa and a 115.5 kDa isoform and is located in the membrane of desmosomes where it moderates cell to cell adhesion. Diseases and disorders such as impetigo, pemphigus foliaceus, skin disease, prostatitis, hypotrichosis, and monilethrix have been researched with this protein. The protein interacts with other proteins including RAB24, MLST8, and PKP3.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: DB, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Publications for Desmoglein-4 Antibody (NBP2-31770) (0)
There are no publications for Desmoglein-4 Antibody (NBP2-31770).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Desmoglein-4 Antibody (NBP2-31770) (0)
There are no reviews for Desmoglein-4 Antibody (NBP2-31770).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Desmoglein-4 Antibody (NBP2-31770) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Desmoglein-4 Products
Research Areas for Desmoglein-4 Antibody (NBP2-31770)
Find related products by research area.
|
Blogs on Desmoglein-4