Desmoglein-4 Antibody

Images

 
Immunohistochemistry-Paraffin: Desmoglein-4 Antibody [NBP2-31770] - Staining of human hair shows strong membranous positivity in cells in cortex and cuticle.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Desmoglein-4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DLDTGNPATDVRYIIGHDAGSWLKIDSRTGEIQFSREFDKKSKYIINGIYTAEILAIDDGSGKTATGTICIEVPDINDYCPNIFPERRTICIDSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DSG4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Desmoglein-4 Protein (NBP2-31770PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Desmoglein-4 Antibody

  • Cad13
  • Cadherin family member 13
  • CDGF13
  • CDHF13
  • CDHF13CDH family member 13
  • desmoglein 4
  • Desmoglein4
  • Desmoglein-4
  • DSG4
  • LAHdesmoglein-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB944
Species: Hu
Applications: WB, IHC
NBP1-78984
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14194
Species: Hu
Applications: IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBL1-12400
Species: Hu
H00003889-B01P
Species: Hu
Applications: WB
AF947
Species: Hu
Applications: WB, Simple Western
NBL1-12547
Species: Hu
NBP2-14197
Species: Hu
Applications: IHC, IHC-P
AF5708
Species: Hu
Applications: WB, ICC
NBP2-50509
Species: Hu
Applications: IHC, IP
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
MAB7265
Species: Mu
Applications: WB, IHC
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for Desmoglein-4 Antibody (NBP2-31770) (0)

There are no publications for Desmoglein-4 Antibody (NBP2-31770).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Desmoglein-4 Antibody (NBP2-31770) (0)

There are no reviews for Desmoglein-4 Antibody (NBP2-31770). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Desmoglein-4 Antibody (NBP2-31770) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Desmoglein-4 Products

Bioinformatics Tool for Desmoglein-4 Antibody (NBP2-31770)

Discover related pathways, diseases and genes to Desmoglein-4 Antibody (NBP2-31770). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Desmoglein-4 Antibody (NBP2-31770)

Discover more about diseases related to Desmoglein-4 Antibody (NBP2-31770).
 

Pathways for Desmoglein-4 Antibody (NBP2-31770)

View related products by pathway.

PTMs for Desmoglein-4 Antibody (NBP2-31770)

Learn more about PTMs related to Desmoglein-4 Antibody (NBP2-31770).

Blogs on Desmoglein-4

There are no specific blogs for Desmoglein-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Desmoglein-4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DSG4
Entrez
Uniprot