Dermcidin Recombinant Protein Antigen

Images

 
There are currently no images for Dermcidin Recombinant Protein Antigen (NBP2-56558PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Dermcidin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Dermcidin.

Source: E. coli

Amino Acid Sequence: AYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DCD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56558.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Dermcidin Recombinant Protein Antigen

  • AIDDdiffusible survival/evasion peptide
  • DCD-1
  • dermcidin
  • DSEPpreproteolysin
  • HCAP
  • MGC71930
  • PIF
  • Preproteolysin
  • proteolysis inducing factor
  • survival promoting peptide

Background

Dermcidin is a protein that has three isoforms, with lengths of 110, 121, and 77 amino acids and weights of approximately 11, 12, and 8 kDa respectively. Dermcidin limits the skin infection of pathogens after a bacterial infection due to its antimicrobial activity as well as functions to aid in phosphatase activity and the survival of neurons. Current studies are being done on several diseases and disorders linked to this protein including clear cell hidradenoma, root caries, angiomyoma, skin conditions, myocardial infarction, hidrocystoma, atopic dermatitis, squamous cell carcinoma, vaginitis, breast cancer, lung cancer, and prostate cancer. Dermcidin has also been shown to have interactions with FAM107A, INPP5K, MDM2, TNFRSF14, and SUMO2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBP2-34014
Species: Hu
Applications: IHC,  IHC-P
M6000B
Species: Mu
Applications: ELISA
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP1-97931
Species: Mu
Applications: ICC/IF (-), IHC,  IHC-P, WB (-)
664-LI
Species: Hu
Applications: BA
NBP2-76393
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC,  IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-86641
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBL1-14964
Species: Hu
Applications: WB
NBP1-86644
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP2-01650
Species: Hu, Pm, Mu
Applications: Flow, IHC,  IHC-P, WB
AF6386
Species: Hu
Applications: IP, WB
MAB864
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP3-38172
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB100-2383
Species: Hu
Applications: ICC/IF, WB

Publications for Dermcidin Recombinant Protein Antigen (NBP2-56558PEP) (0)

There are no publications for Dermcidin Recombinant Protein Antigen (NBP2-56558PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dermcidin Recombinant Protein Antigen (NBP2-56558PEP) (0)

There are no reviews for Dermcidin Recombinant Protein Antigen (NBP2-56558PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dermcidin Recombinant Protein Antigen (NBP2-56558PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dermcidin Products

Research Areas for Dermcidin Recombinant Protein Antigen (NBP2-56558PEP)

Find related products by research area.

Blogs on Dermcidin

There are no specific blogs for Dermcidin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dermcidin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DCD