Derlin 1 Recombinant Protein Antigen

Images

 
There are currently no images for Derlin 1 Protein (NBP1-88023PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Derlin 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DERL1.

Source: E. coli

Amino Acid Sequence: LMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DERL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88023.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Derlin 1 Recombinant Protein Antigen

  • DER-1
  • DER1Degradation in endoplasmic reticulum protein 1
  • Der1-like domain family, member 1
  • Der1-like protein 1
  • derlin-1
  • DERtrin-1
  • FLJ13784
  • FLJ42092
  • MGC3067
  • PRO2577

Background

Degradation in Endoplasmic Reticulum protein 1 (Derlin1) is a channel-like protein, found in the ER membrane, responsible for degrading and funneling misfolded proteins and other cellular debris into the appropriate degradative pathways within the cell. Specifically, Derlin-1 is thought to form a channel to allow retrotranslocation of misfolded proteins into the cytosol where they may be ubiquitinated and degraded by the proteasome.

Derlin 1 antibodies will serve as useful tools for protein degradation studies and for research on certian types of cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NB100-1483
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, PEP-ELISA, PLA, WB
NB100-2526
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NB110-40591
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-43772
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-47485
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-89558
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
H00091319-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-93746
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1543
Species: Hu
Applications: IHC, WB
NBP2-61829
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
H00009695-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-45970
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for Derlin 1 Protein (NBP1-88023PEP) (0)

There are no publications for Derlin 1 Protein (NBP1-88023PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Derlin 1 Protein (NBP1-88023PEP) (0)

There are no reviews for Derlin 1 Protein (NBP1-88023PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Derlin 1 Protein (NBP1-88023PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Derlin 1 Products

Research Areas for Derlin 1 Protein (NBP1-88023PEP)

Find related products by research area.

Blogs on Derlin 1

There are no specific blogs for Derlin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Derlin 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DERL1