Derlin 1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Derlin 1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DERL1.
  
  

  Source: E. coli

  Amino Acid Sequence: LMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: DERL1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88023.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Derlin 1 Recombinant Protein Antigen

• DER-1
• DER1Degradation in endoplasmic reticulum protein 1
• Der1-like domain family, member 1
• Der1-like protein 1
• derlin-1
• DERtrin-1
• FLJ13784
• FLJ42092
• MGC3067
• PRO2577

Background

Degradation in Endoplasmic Reticulum protein 1 (Derlin1) is a channel-like protein, found in the ER membrane, responsible for degrading and funneling misfolded proteins and other cellular debris into the appropriate degradative pathways within the cell. Specifically, Derlin-1 is thought to form a channel to allow retrotranslocation of misfolded proteins into the cytosol where they may be ubiquitinated and degraded by the proteasome.

Derlin 1 antibodies will serve as useful tools for protein degradation studies and for research on certian types of cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DERL1