Recombinant Human DEPDC1A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DEPDC1A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 93-186 of Human DEPDC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSIFKLRNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DEPDC1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DEPDC1A Protein

  • cell cycle control protein SDP35
  • DEP domain containing 1,5830484J08Rik
  • DEP domain-containing protein 1A
  • DEP.8
  • DEPDC1ADEPDC1-V2
  • FLJ20354
  • SDP35

Background

DEPDC1 - DEP domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB400-132
Species: Hu, Mu, Rt, ChHa, Ha, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-P, In vitro
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP1-84275
Species: Hu
Applications: IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-30794
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-56630
Species: Hu
Applications: WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15447
Species: Hu
Applications: WB
NBP1-84342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13685
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4210
Species: Hu
Applications: WB, IHC
MAB1934
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP1-31632
Species: Hu
Applications: WB, ICC/IF
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-88042
Species: Hu
Applications: IHC, IHC-P
H00055635-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for DEPDC1A Partial Recombinant Protein (H00055635-Q01) (0)

There are no publications for DEPDC1A Partial Recombinant Protein (H00055635-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DEPDC1A Partial Recombinant Protein (H00055635-Q01) (0)

There are no reviews for DEPDC1A Partial Recombinant Protein (H00055635-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DEPDC1A Partial Recombinant Protein (H00055635-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DEPDC1A Products

Bioinformatics Tool for DEPDC1A Partial Recombinant Protein (H00055635-Q01)

Discover related pathways, diseases and genes to DEPDC1A Partial Recombinant Protein (H00055635-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DEPDC1A Partial Recombinant Protein (H00055635-Q01)

Discover more about diseases related to DEPDC1A Partial Recombinant Protein (H00055635-Q01).
 

Pathways for DEPDC1A Partial Recombinant Protein (H00055635-Q01)

View related products by pathway.

Research Areas for DEPDC1A Partial Recombinant Protein (H00055635-Q01)

Find related products by research area.

Blogs on DEPDC1A

There are no specific blogs for DEPDC1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABCA1 Antibody
NB400-105
DEPDC1A Antibody
26630002-0.1mg
ABCG1 Antibody
NB400-132

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DEPDC1A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DEPDC1