delta Opioid R/OPRD1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit delta Opioid R/OPRD1 Antibody - BSA Free (NBP3-38545) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 300-372 of human delta Opioid R/OPRD1 (NP_000902.3).
Sequence: LHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
OPRD1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for delta Opioid R/OPRD1 Antibody - BSA Free
Background
G protein-coupled receptors (GPCRs) are the largest family of membrane receptors that activate intracellular signaling cascades and undergo endocytosis, recycling, or degradation upon stimulation. The mu, delta and kappa opioid receptors are GPCRs of the nervous system, which control pain, stress, and addictive behaviors. The delta opioid receptor (DOR-1) is the stereo selective receptor for enkephalins and inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Rt
Applications: IHC
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu
Applications: IHC, WB
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ch
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA
Publications for delta Opioid R/OPRD1 Antibody (NBP3-38545) (0)
There are no publications for delta Opioid R/OPRD1 Antibody (NBP3-38545).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for delta Opioid R/OPRD1 Antibody (NBP3-38545) (0)
There are no reviews for delta Opioid R/OPRD1 Antibody (NBP3-38545).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for delta Opioid R/OPRD1 Antibody (NBP3-38545) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional delta Opioid R/OPRD1 Products
Research Areas for delta Opioid R/OPRD1 Antibody (NBP3-38545)
Find related products by research area.
|
Blogs on delta Opioid R/OPRD1