delta Opioid R/OPRD1 Antibody (1R4W8) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human delta Opioid R/OPRD1 (P41143). MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATS |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
OPRD1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for delta Opioid R/OPRD1 Antibody (1R4W8)
Background
G protein-coupled receptors (GPCRs) are the largest family of membrane receptors that activate intracellular signaling cascades and undergo endocytosis, recycling, or degradation upon stimulation. The mu, delta and kappa opioid receptors are GPCRs of the nervous system, which control pain, stress, and addictive behaviors. The delta opioid receptor (DOR-1) is the stereo selective receptor for enkephalins and inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Rt
Applications: IHC
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu, Rt
Applications: IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ch
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Publications for delta Opioid R/OPRD1 Antibody (NBP3-16680) (0)
There are no publications for delta Opioid R/OPRD1 Antibody (NBP3-16680).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for delta Opioid R/OPRD1 Antibody (NBP3-16680) (0)
There are no reviews for delta Opioid R/OPRD1 Antibody (NBP3-16680).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for delta Opioid R/OPRD1 Antibody (NBP3-16680) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional delta Opioid R/OPRD1 Products
Research Areas for delta Opioid R/OPRD1 Antibody (NBP3-16680)
Find related products by research area.
|
Blogs on delta Opioid R/OPRD1