delta Opioid R/OPRD1 Antibody (1R4W8)

Western Blot: delta Opioid R/OPRD1 Antibody (1R4W8) [NBP3-16680] - Western blot analysis of extracts of various cell lines, using delta Opioid R/OPRD1 Rabbit mAb (NBP3-16680) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 1R4W8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

delta Opioid R/OPRD1 Antibody (1R4W8) Summary

• Description: Novus Biologicals Rabbit delta Opioid R/OPRD1 Antibody (1R4W8) (NBP3-16680) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human delta Opioid R/OPRD1 (P41143). MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: OPRD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for delta Opioid R/OPRD1 Antibody (1R4W8)

• delta Opioid R
• delta opioid receptor 1
• delta-type opioid receptor
• DOP
• dOpioidR
• DOR1
• D-OR-1
• DOR-1
• OP1
• opioid receptor, delta 1
• OPRD
• OPRD1

Background

G protein-coupled receptors (GPCRs) are the largest family of membrane receptors that activate intracellular signaling cascades and undergo endocytosis, recycling, or degradation upon stimulation. The mu, delta and kappa opioid receptors are GPCRs of the nervous system, which control pain, stress, and addictive behaviors. The delta opioid receptor (DOR-1) is the stereo selective receptor for enkephalins and inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OPRD1