DELGEF Antibody


Immunocytochemistry/ Immunofluorescence: DELGEF Antibody [NBP2-56065] - Staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

DELGEF Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SLFGCPIQQVACGWDFTIMLTENGQVLSCGSNSFGQLGVPHGPRRCVVPQAIELHKEKVVCIAAGLRHAVAATASGIVFQW
Specificity of human DELGEF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DELGEF Recombinant Protein Antigen (NBP2-56065PEP)

Reactivity Notes

Mouse 83%, Rat 80%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for DELGEF Antibody

  • Deafness locus-associated putative guanine nucleotide exchange factor
  • DelGEF
  • DELGEFdeafness locus associated putative guanine nucleotide exchange factor
  • Gnefr
  • Guanine nucleotide exchange factor-related protein
  • secretion regulating guanine nucleotide exchange factor
  • secretion-regulating guanine nucleotide exchange factor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, ChIP
Species: Hu
Applications: ICC/IF

Publications for DELGEF Antibody (NBP2-56065) (0)

There are no publications for DELGEF Antibody (NBP2-56065).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DELGEF Antibody (NBP2-56065) (0)

There are no reviews for DELGEF Antibody (NBP2-56065). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DELGEF Antibody (NBP2-56065) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional DELGEF Products

Bioinformatics Tool for DELGEF Antibody (NBP2-56065)

Discover related pathways, diseases and genes to DELGEF Antibody (NBP2-56065). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DELGEF

There are no specific blogs for DELGEF, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DELGEF Antibody and receive a gift card or discount.


Gene Symbol SERGEF