DDX21 Antibody


Western Blot: DDX21 Antibody [NBP2-38311] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-DDX21 antibody. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: DDX21 Antibody [NBP2-38311] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Staining in human appendix and skeletal muscle tissues using anti-DDX21 antibody. Corresponding DDX21 RNA-seq data are presented for the same tissues.
Western Blot: DDX21 Antibody [NBP2-38311] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry: DDX21 Antibody [NBP2-38311] - Staining of human vulva/anal skin shows strong nucleolar positivity in epidermal cells.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD

Order Details

DDX21 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: DSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ
Specificity of human DDX21 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDX21 Protein (NBP2-38311PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DDX21 Antibody

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
  • DEAD box protein 21
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21
  • DKFZp686F21172
  • EC 3.6.1
  • EC
  • Gu protein
  • GUA
  • gu-alpha
  • nucleolar RNA helicase 2
  • Nucleolar RNA helicase Gu
  • Nucleolar RNA helicase II
  • RH II/Gu
  • RH-II/GU
  • RH-II/GuA
  • RNA helicase II/Gu alpha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP, ICC, IF
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Dr, Eq, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for DDX21 Antibody (NBP2-38311) (0)

There are no publications for DDX21 Antibody (NBP2-38311).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX21 Antibody (NBP2-38311) (0)

There are no reviews for DDX21 Antibody (NBP2-38311). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DDX21 Antibody (NBP2-38311) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for DDX21 Antibody (NBP2-38311)

Discover related pathways, diseases and genes to DDX21 Antibody (NBP2-38311). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX21 Antibody (NBP2-38311)

Discover more about diseases related to DDX21 Antibody (NBP2-38311).

Pathways for DDX21 Antibody (NBP2-38311)

View related products by pathway.

PTMs for DDX21 Antibody (NBP2-38311)

Learn more about PTMs related to DDX21 Antibody (NBP2-38311).

Blogs on DDX21.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DDX21 Antibody and receive a gift card or discount.


Gene Symbol DDX21