We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DDX21 Antibody - BSA Free

Images

 
Western Blot: DDX21 Antibody [NBP2-38311] - Analysis using Anti-DDX21 antibody NBP2-38311 (A) shows similar pattern to independent antibody NBP1-83310 (B).
Immunocytochemistry/ Immunofluorescence: DDX21 Antibody [NBP2-38311] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Staining of human appendix shows strong positivity in nucleoli in lymphoid tissue.
Orthogonal Strategies: Western Blot: DDX21 Antibody [NBP2-38311] - Western blot analysis in human cell lines Caco-2 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Analysis in human appendix and skeletal muscle tissues using NBP2-38311 antibody. Corresponding DDX21 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Staining of human skeletal muscle shows no positivity in nucleoli in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, Mycoplasma
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

DDX21 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX21
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 1:100 - 1:250
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDX21 Protein (NBP2-38311PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DDX21 Antibody - BSA Free

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
  • DEAD box protein 21
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21
  • DKFZp686F21172
  • EC 3.6.1
  • EC 3.6.4.13
  • Gu protein
  • GUA
  • gu-alpha
  • GURDB
  • nucleolar RNA helicase 2
  • Nucleolar RNA helicase Gu
  • Nucleolar RNA helicase II
  • RH II/Gu
  • RH-II/GU
  • RH-II/GuA
  • RNA helicase II/Gu alpha

Background

DDX21 is a member of the DEAD box family of proteins that possesses several conserved motifs which include the highly conserved DEAD (Asp-Glu-Ala-Asp) amino acid sequence motif. The major activity of DEAD box proteins is to function as ATP-dependent RNA helicases. As helicases, DEAD proteins play an important role in all aspects of RNA metabolism and function which include pre-mRNA splicing, RNA synthesis, RNA degradation, RNA export, RNA translation, RNA secondary structure formation, ribosome biogenesis, and the assembly of RNP complexes. Some members of the DEAD box proteins also exhibit functions involved in transcriptional regulation. DDX21 has been shown to be required for the processing of 20S rRNA to 18S and has also been shown to be important for c-Jun transcriptional activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-16858
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-38571
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-38985
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP1-92192
Species: Hu, Mu, Rt
Applications: ICC/IF,  IHC-P, WB
NB200-351
Species: Ha, Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-14119
Species: Hu
Applications: IHC,  IHC-P
NBP2-49612
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NB100-79781
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-16628
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB300-269
Species: Bv, Ce, Ch, Dr, Eq, Hu, Mu, Pl, Po, Rt, Y, Ye
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KD, WB
NBP1-84022
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-314
Species: Bv, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-52454
Species: Hu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, WB
NBP2-38311
Species: Hu
Applications: WB, ICC/IF, IHC, Mycoplasma

Publications for DDX21 Antibody (NBP2-38311) (0)

There are no publications for DDX21 Antibody (NBP2-38311).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX21 Antibody (NBP2-38311) (0)

There are no reviews for DDX21 Antibody (NBP2-38311). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DDX21 Antibody (NBP2-38311) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX21 Products

Blogs on DDX21.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX21 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX21
Uniprot