DDX21 Antibody

Images

 
Orthogonal Strategies: Western Blot: DDX21 Antibody [NBP2-38311] - Western blot analysis in human cell lines Caco-2 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: DDX21 Antibody [NBP2-38311] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Staining in human appendix and skeletal muscle tissues using anti-DDX21 antibody. Corresponding DDX21 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP2-38311] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

DDX21 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ
Specificity
Specificity of human DDX21 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDX21 Protein (NBP2-38311PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDX21 Antibody

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
  • DEAD box protein 21
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21
  • DKFZp686F21172
  • EC 3.6.1
  • EC 3.6.4.13
  • Gu protein
  • GUA
  • gu-alpha
  • GURDB
  • nucleolar RNA helicase 2
  • Nucleolar RNA helicase Gu
  • Nucleolar RNA helicase II
  • RH II/Gu
  • RH-II/GU
  • RH-II/GuA
  • RNA helicase II/Gu alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-77158
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-83311
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-352
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-351
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-59109
Species: Hu
Applications: WB, IHC, IHC-P
NB120-3446
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP, ICC, IF
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-269
Species: Hu, Mu, Rt, Po, Bv, Ch, Dr, Eq, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-315
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84058
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38311
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for DDX21 Antibody (NBP2-38311) (0)

There are no publications for DDX21 Antibody (NBP2-38311).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX21 Antibody (NBP2-38311) (0)

There are no reviews for DDX21 Antibody (NBP2-38311). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DDX21 Antibody (NBP2-38311) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DDX21 Antibody (NBP2-38311)

Discover related pathways, diseases and genes to DDX21 Antibody (NBP2-38311). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX21 Antibody (NBP2-38311)

Discover more about diseases related to DDX21 Antibody (NBP2-38311).
 

Pathways for DDX21 Antibody (NBP2-38311)

View related products by pathway.

PTMs for DDX21 Antibody (NBP2-38311)

Learn more about PTMs related to DDX21 Antibody (NBP2-38311).

Blogs on DDX21.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX21
Uniprot