DDX21 Antibody


Orthogonal Strategies: Western Blot: DDX21 Antibody [NBP1-83310] - Analysis in human cell lines Caco-2 and HeLa using Anti-DDX21 antibody. Corresponding DDX21 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: DDX21 Antibody [NBP1-83310] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DDX21 Antibody [NBP1-83310] - Staining in human appendix and skeletal muscle tissues using anti-DDX21 antibody. Corresponding DDX21 RNA-seq data are presented ...read more
Western Blot: DDX21 Antibody [NBP1-83310] - Analysis in human cell line HL-60.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP1-83310] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP1-83310] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ChIP, ICC/IF, IHC, IHC-P, In vitro
Validated by:

Orthogonal Strategies


Order Details

DDX21 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVV
Specificity of human DDX21 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Chromatin Immunoprecipitation
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • In vitro assay
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. In vivo assay was reported in scientific literature. Use in chromatin immunoprecipitation reported in scientific literature (PMID 25470060)
Control Peptide
DDX21 Protein (NBP1-83310PEP)
Reviewed Applications
Read 1 Review rated 3
NBP1-83310 in the following applications:

Read Publications using
NBP1-83310 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DDX21 Antibody

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
  • DEAD box protein 21
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21
  • DKFZp686F21172
  • EC 3.6.1
  • EC
  • Gu protein
  • GUA
  • gu-alpha
  • nucleolar RNA helicase 2
  • Nucleolar RNA helicase Gu
  • Nucleolar RNA helicase II
  • RH II/Gu
  • RH-II/GU
  • RH-II/GuA
  • RNA helicase II/Gu alpha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP, ICC, IF
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Dr, Eq, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, In vitro

Publications for DDX21 Antibody (NBP1-83310)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ChIP, In vitro.

Filter By Application
In vitro
All Applications
Filter By Species
All Species

Review for DDX21 Antibody (NBP1-83310) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-83310:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
reviewed by:
Nadine Bakkar
WB Human 09/26/2014


ApplicationWestern Blot
Sample Testedhuman brain lysate
CommentsMultiple additional non-specific bands


Blocking DetailsLicoR blocking buffer

Primary Anitbody

Dilution Ratio1:500

Secondary Antibody

Secondary DescriptionLicor IR680
Secondary Concentration1:3000


CommentsMultiple additional non-specific bands

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Webinar
ChIP Video Protocol
ICC/IF Video Protocol

FAQs for DDX21 Antibody (NBP1-83310) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for DDX21 Antibody (NBP1-83310)

Discover related pathways, diseases and genes to DDX21 Antibody (NBP1-83310). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX21 Antibody (NBP1-83310)

Discover more about diseases related to DDX21 Antibody (NBP1-83310).

Pathways for DDX21 Antibody (NBP1-83310)

View related products by pathway.

PTMs for DDX21 Antibody (NBP1-83310)

Learn more about PTMs related to DDX21 Antibody (NBP1-83310).

Blogs on DDX21.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Nadine Bakkar
Application: WB
Species: Human


Gene Symbol DDX21