DDX21 Antibody

Images

 
Western Blot: DDX21 Antibody [NBP1-83310] - Analysis using Anti-DDX21 antibody NBP1-83310 (A) shows similar pattern to independent antibody NBP2-38311 (B).
Immunocytochemistry/ Immunofluorescence: DDX21 Antibody [NBP1-83310] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DDX21 Antibody [NBP1-83310] - Staining in human appendix and skeletal muscle tissues using anti-DDX21 antibody. Corresponding DDX21 RNA-seq data are presented ...read more
Western Blot: DDX21 Antibody [NBP1-83310] - Analysis in human cell line HL-60.
Orthogonal Strategies: Western Blot: DDX21 Antibody [NBP1-83310] - Analysis in human cell lines Caco-2 and HeLa using Anti-DDX21 antibody. Corresponding DDX21 RNA-seq data are presented for the same cell lines. ...read more
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP1-83310] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: DDX21 Antibody [NBP1-83310] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ChIP, ICC/IF, IHC, IHC-P, In vitro
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

DDX21 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVV
Specificity
Specificity of human DDX21 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Chromatin Immunoprecipitation
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • In vitro assay
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. In vivo assay was reported in scientific literature. Use in chromatin immunoprecipitation reported in scientific literature (PMID 25470060)
Control Peptide
DDX21 Protein (NBP1-83310PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-83310 in the following applications:

Publications
Read Publications using
NBP1-83310 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDX21 Antibody

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
  • DEAD box protein 21
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21
  • DKFZp686F21172
  • EC 3.6.1
  • EC 3.6.4.13
  • Gu protein
  • GUA
  • Gu-alpha
  • GURDB
  • nucleolar RNA helicase 2
  • Nucleolar RNA helicase Gu
  • Nucleolar RNA helicase II
  • RH II/Gu
  • RH-II/GU
  • RH-II/GuA
  • RNA helicase II/Gu alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-77158
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-83311
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-352
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-351
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-14119
Species: Hu
Applications: IHC, IHC-P
NB120-3446
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP, ICC, IF
NB100-79781
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-269
Species: Hu, Mu, Rt, Po, Bv, Ch, Dr, Eq, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-315
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84058
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83310
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, In vitro

Publications for DDX21 Antibody (NBP1-83310)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ChIP, In vitro.


Filter By Application
ChIP
(1)
In vitro
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for DDX21 Antibody (NBP1-83310) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-83310:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Nadine Bakkar
WB Human 09/26/2014
View

Summary

ApplicationWestern Blot
Sample Testedhuman brain lysate
SpeciesHuman
CommentsMultiple additional non-specific bands

Blocking

Blocking DetailsLicoR blocking buffer

Primary Anitbody

Dilution Ratio1:500

Secondary Antibody

Secondary DescriptionLicor IR680
Secondary Concentration1:3000

Comments

CommentsMultiple additional non-specific bands

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Webinar
ChIP Video Protocol
ICC/IF Video Protocol

FAQs for DDX21 Antibody (NBP1-83310) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DDX21 Antibody (NBP1-83310)

Discover related pathways, diseases and genes to DDX21 Antibody (NBP1-83310). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX21 Antibody (NBP1-83310)

Discover more about diseases related to DDX21 Antibody (NBP1-83310).
 

Pathways for DDX21 Antibody (NBP1-83310)

View related products by pathway.

PTMs for DDX21 Antibody (NBP1-83310)

Learn more about PTMs related to DDX21 Antibody (NBP1-83310).

Blogs on DDX21.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

 
Nadine Bakkar
09/26/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol DDX21