DDX11 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DDX11 Antibody [NBP2-38060] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus.

Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060] - Staining of human small intestine shows strong nuclear positivity in lymphoid and glandular cells.

Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060] - Staining of human lymph node shows moderate nuclear positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: DDX11 Antibody [NBP2-38060] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DDX11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DDX11 Antibody - BSA Free (NBP2-38060) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKKEERDLV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DDX11 Protein (NBP2-38060PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DDX11 Antibody - BSA Free

• CHL1CHL1-related helicase gene-1
• CHL1-related protein 1
• CHLR1MGC9335
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (CHL1-like helicase homolog, S.cerevisiae)
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (S.cerevisiae CHL1-likehelicase)
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11
• DEAD/H box protein 11
• EC 3.6.1
• EC 3.6.1.23
• EC 3.6.1.7
• EC 3.6.4.13
• hCHLR1
• Keratinocyte growth factor-regulated gene 2 protein
• KRG-2
• KRG2CHL1-like helicase homolog
• MGC133249
• probable ATP-dependent RNA helicase DDX11

Background

DDX11, also known as Probable ATP-dependent RNA helicase DDX11, consists of five isoforms of sizes of 108.3 kDa, 101.7 kDa, 98.7 kDa, 96.1 kDa, and 33 kDa and is involved in cellular proliferation and alteration of RNA secondary structure. Current research is being conducted for diseases and disorders including anemia, carcinoma, malaria, coloboma, and Roberts syndrome. The protein interacts in metabolism of proteins and unfolded protein response pathways with KAT7, FEN1, PCNA, PFN2, and RFC2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX11
• Uniprot:
  • Q96FC9(Human)