DCTN3 Antibody - Azide and BSA Free

Western Blot: DCTN3 Antibody [H00011258-B01P] - Analysis of DCTN3 expression in transfected 293T cell line by DCTN3 polyclonal antibody. Lane 1: DCTN3 transfected lysate(19.36 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: DCTN3 Antibody [H00011258-B01P] - Analysis of purified antibody to DCTN3 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DCTN3 Antibody - Azide and BSA Free Summary

• Immunogen: DCTN3 (NP_077324.1, 1 a.a. - 176 a.a.) full-length human protein. MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH
• Specificity: DCTN3 - dynactin 3 (p22),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: DCTN3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Has also been used for immunofluorescence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DCTN3 Antibody - Azide and BSA Free

• DCTN22DCTN-22
• dynactin 3 (p22)
• dynactin 3
• Dynactin complex subunit 22 kDa subunit
• dynactin light chain
• dynactin subunit 3
• MGC111190
• p22

Background

This gene encodes the smallest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, cytokinesis, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like most other dynactin subunits, exists only as a part of the dynactin complex. It is primarily an alpha-helical protein with very little coiled coil, and binds directly to the largest subunit (p150) of dynactin. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DCTN3 Antibody (H00011258-B01P)(1)

Publication using H00011258-B01P

• Saito K, Murayama T, Hata T et al. Conformational diversity of dynactin sidearm and domain organization of its subunit p150 Mol. Biol. Cell 2020-04-02 [PMID: 32238103] (WB)

Bioinformatics

• Gene Symbol: DCTN3
• Entrez:
  • 11258(Human)
• Uniprot:
  • NP_077324.1(Human)