Home » DCPS » DCPS Proteins » DCPS Recombinant Protein Antigen

DCPS Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DCPS Protein (NBP1-81749PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

DCPS Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DCPS.

Source: E.coli

Amino Acid Sequence: QLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASGDGDGEDAVVILEKTPFQVEQVAQLLTGSPE
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DCPS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81749.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for DCPS Recombinant Protein Antigen

  • DCS1
  • DCS-1
  • decapping enzyme, scavenger
  • EC 3.-
  • heat shock-like protein 1
  • HINT5
  • HINT-5homolog of C. elegans 7meGMP-directed hydrolase dcs-1
  • Hint-related 7meGMP-directed hydrolase
  • Histidine triad protein member 5
  • HSL1
  • HSPC015
  • mRNA decapping enzyme
  • scavenger mRNA-decapping enzyme DcpS

Background

Necessary for the complete degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA fragments shorter than 10 nucleotides that are produced by 3'->5' exosome-mediated mRNA decay. Releases m7GMP. Can also degrade m7GDP to m7GMP. Has no activity towards mRNA molecules longer than 25 nucleotides

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DCP2 Antibody
NBP2-16109
Western Blot: DCP2 Antibody [NBP2-16109] - Sample (30 ug of whole cell lysate) A: IMR32 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: DCP2 Antibody [NBP2-16109] - Zebrafish blastula cells expressing GFP-Rbpms2 fusions. Wild-type GFP-Rbpms2b localizes near the nucleus (top row), is apparently associated with the centrosome/spindle in some cells. (Top row) A subset of GFP-Rbpms2b positive granules are positive for the p-body marker Dcp2. (Second row) GFP-Rbpms2bsa9329 localization to the centrosome/spindle but not granules. (Third rod) GFP-Rbpms2bae32 and (Final row) GFP-Rbpms2aae30 localization. Insets show magnified views of the highlighted cells. Images are representative slices from Z-stacks of sphere stage embryos viewed from the animal pole. Image collected and cropped by CiteAb from the following publication (dx.plos.org/10.1371/journal.pgen.1007489) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: DCP2 Antibody [NBP2-16109] - Mouse testis. DCP2 antibody dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(2 Publications)
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, ISH, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(4 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
DCP1B Antibody
NBP1-82018
Western Blot: DCP1B Antibody [NBP1-82018] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: DCP1B Antibody [NBP1-82018] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: DCP1B Antibody [NBP1-82018] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot: eIF4E [p Ser209] Antibody [NB100-81898] - Analysis of extracts from SK-BR-3 cells, untreated or insulin and EGF treated, and pretreated with U0126 cells, using eIF4E (Phospho-Ser209) Antibody.
Immunocytochemistry/Immunofluorescence: eIF4E [p Ser209] Antibody [NB100-81898] - Staining of methanol-fixed MCF cells using eIF4E(Phospho-Ser209) antibody
Immunohistochemistry: eIF4E [p Ser209] Antibody [NB100-81898] - Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue, using elF4E (phospho-Ser209) antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Coagulation Factor
XIV/Protein C Antibod ...
NBP1-86509
Immunohistochemistry-Paraffin: Coagulation Factor XIV/Protein C Antibody [NBP1-86509] - Staining of human fallopian tube shows positivity in plasma.
Immunohistochemistry-Paraffin: Coagulation Factor XIV/Protein C Antibody [NBP1-86509] - Staining of human liver shows weak cytoplasmic positivity in hepatocytes and strong positivity in plasma.
Immunohistochemistry-Paraffin: Coagulation Factor XIV/Protein C Antibody [NBP1-86509] - Staining of human skin shows no positivity in squamous epithelial cells as expected.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human kidney shows high expression.
Species: Hu
Applications: IHC, IHC-P, WB
CRAT Antibody
NBP1-86616
Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.
Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/Immunofluorescence: APC Antibody [NB100-91662] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-APC Antibody at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: APC Antibody [NB100-91662] - An intracellular stain was performed on HeLa cells with APC Antibody NB100-91662AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunohistochemistry-Paraffin: APC Antibody [NB100-91662] - Paraffin-embedded human colon carcinoma tissue.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
FANCD2 Antibody -
BSA Free
NB100-182
Immunocytochemistry/Immunofluorescence: FANCD2 Antibody - BSA Free [NB100-182] - FANCD2 Antibody [NB100-182] - Analysis using the Biotin conjugate of FANCD2 Antibody. FANCD2 colocalizes in vivo with another protein in SiHa cells after cell exposure to IR. Proliferating SiHa cells were exposed to 10 Gy of IR and double color immunofluorescence staining was performed after 8 h. Images were captured in a Kodak digital image system on a Leica fluorescence microscope.
Knockdown Validated: FANCD2 Antibody - BSA Free [NB100-182] - FANCD2 Antibody [NB100-182] - Resistance of FANCA-mutant cells with defective FANCD2 function to hydrogen peroxide (H2O2). Representative images illustrating staining for subnuclear FANCD2 foci in isogenic fibroblast pairs, either deficient for FANCD2 (PD20) or FANCA (PD220) and their respective wild-type (wt) complemented counterparts. Foci were visualized three hours after treatment with H2O2 (25 uM for 2 hours). Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/bmri/2008/821529/) licensed under a CC-BY licence.
Western Blot: FANCD2 Antibody - BSA Free [NB100-182] - FANCD2 Antibody [NB100-182] - AICAR-induced FANCD2 monoubiquitination is dependent on AMPK. Inhibitor of AMPK blocks AICAR-induced FANCD2 monoubiquitination in GM00637I normal fibroblasts. Cells were pretreated with 5 um of Compound C (an AMPK inhibitor) 1 h before treatment with 0.25 mm AICAR for 24 h. Cell lysates were subjected to immunoblotting with FANCD2 Antibody to visualize monoubiquitinated FANCD2 (Ub-ANCD2). Image collected and cropped by CiteAb from the following publication (http://doi.wiley.com/10.1002/2211-5463.12185) licensed under a CC-BY licence.
(8 Reviews)
(192 Publications)
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
BRCA2 Antibody
(234403) [Unconjugate
MAB2476
Western blot shows lysates of Capan‑1 human pancreatic adenocarcinoma cell line, HeLa human cervical epithelial carcinoma cell line, and U2OS human osteosarcoma cell line. PVDF membrane was probed with 0.2 µg/mL of Human BRCA2 Monoclonal Antibody (Catalog # MAB2476) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for BRCA2 at approximately 380 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(6 Publications)
Species: Hu
Applications: IHC, WB
Wee1 Antibody
NBP1-33506
Western Blot: Wee1 Antibody [NBP1-33506] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with WEE1 antibody [N3C2], diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Wee1 Antibody [NBP1-33506] - CL1-0 Xenograft, using WEE1 antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: Wee1 Antibody [NBP1-33506] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membranes were blotted with WEE1 antibody [N3C2], Internal diluted at 1:1000.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
FMN1 Antibody (4F4)
H00342184-M07
ELISA: FMN1 Antibody (4F4) [H00342184-M07] - Detection limit for recombinant GST tagged FMN1 is 3 ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: FMN1 Antibody (4F4) [H00342184-M07] - Analysis of monoclonal antibody to FMN1 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: FMN1 Antibody (4F4) [H00342184-M07] - Analysis of FMN1 expression in human colon.
Species: Hu
Applications: ELISA, ICC/IF, WB
KCC4/SLC12A7
Antibody
NBP1-85133
Immunohistochemistry-Paraffin: KCC4/SLC12A7 Antibody [NBP1-85133] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: KCC4/SLC12A7 Antibody [NBP1-85133] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: KCC4/SLC12A7 Antibody [NBP1-85133] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Presenilin-1
Antibody (APS 18)
NB100-74510
Western Blot: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of THP-1 cell lysate.
Immunocytochemistry/Immunofluorescence: Presenilin-1 Antibody (APS 18) [NB100-74510] - Staining of PS1 in mouse fibroblasts.
Immunocytochemistry/Immunofluorescence: Presenilin-1 Antibody (APS 18) [NB100-74510] - Analysis of Presenilin 1 using Presenilin 1 Monoclonal antibody (APS 18) shows staining in MCF-7 cells. Presenilin 1 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Presenilin 1 at a dilution of 1:20-1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(1 Review)
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Hormone-sensitive
Lipase/HSL Antibody
NB110-37253
Western Blot: HSL Antibody [NB110-37253] - Detection of HSL using NB110-37253. Lane 1: Liver extract (negative control) Lane 2: Fat extract (10ug) (positive sample).
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB
FZR1/CDH1 Antibody
NBP2-15840
Western Blot: FZR1/CDH1 Antibody [NBP2-15840] - Cdh1 decreases upon Abeta treatment in neurons. Representative Western blot image of cdh1 after different time points in control conditions or with Abeta treatment. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep31158), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: FZR1/CDH1 Antibody [NBP2-15840] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: FZR1 protein stained by FZR1 antibody diluted at 1:500. Red: Phalloidin, a cytoskeleton marker, diluted at 1:100. Scale bar = 10 um.
Immunohistochemistry-Paraffin: FZR1/CDH1 Antibody [NBP2-15840] - Mouse heart. FZR1 antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DCPS Recombinant
Protein Antigen
NBP1-81749PEP
DCPS Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for DCPS Protein (NBP1-81749PEP) (0)

There are no publications for DCPS Protein (NBP1-81749PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DCPS Protein (NBP1-81749PEP) (0)

There are no reviews for DCPS Protein (NBP1-81749PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DCPS Protein (NBP1-81749PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DCPS Products

Bioinformatics Tool for DCPS Protein (NBP1-81749PEP)

Discover related pathways, diseases and genes to DCPS Protein (NBP1-81749PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DCPS Protein (NBP1-81749PEP)

Discover more about diseases related to DCPS Protein (NBP1-81749PEP).
 

Pathways for DCPS Protein (NBP1-81749PEP)

View related products by pathway.

PTMs for DCPS Protein (NBP1-81749PEP)

Learn more about PTMs related to DCPS Protein (NBP1-81749PEP).
 

Research Areas for DCPS Protein (NBP1-81749PEP)

Find related products by research area.

Blogs on DCPS

There are no specific blogs for DCPS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: FANCD2 Antibody - BSA Free [NB100-182] - FANCD2 Antibody [NB100-182] - Analysis using the Biotin conjugate of FANCD2 Antibody. FANCD2 colocalizes in vivo with another protein in SiHa cells after cell exposure to IR. Proliferating SiHa cells were exposed to 10 Gy of IR and double color immunofluorescence staining was performed after 8 h. Images were captured in a Kodak digital image system on a Leica fluorescence microscope.
FANCD2 Antibody - BSA Free
NB100-182
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Catalase Antibody [Unconjugated]
AF3398

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DCPS Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DCPS