DCPS Recombinant Protein Antigen

Images

 
There are currently no images for DCPS Protein (NBP1-81749PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DCPS Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DCPS.

Source: E.coli

Amino Acid Sequence: QLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASGDGDGEDAVVILEKTPFQVEQVAQLLTGSPE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DCPS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81749.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for DCPS Recombinant Protein Antigen

  • DCS1
  • DCS-1
  • decapping enzyme, scavenger
  • EC 3.-
  • heat shock-like protein 1
  • HINT5
  • HINT-5homolog of C. elegans 7meGMP-directed hydrolase dcs-1
  • Hint-related 7meGMP-directed hydrolase
  • Histidine triad protein member 5
  • HSL1
  • HSPC015
  • mRNA decapping enzyme
  • scavenger mRNA-decapping enzyme DcpS

Background

Necessary for the complete degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA fragments shorter than 10 nucleotides that are produced by 3'->5' exosome-mediated mRNA decay. Releases m7GMP. Can also degrade m7GDP to m7GMP. Has no activity towards mRNA molecules longer than 25 nucleotides

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16109
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, ISH, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-82018
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP1-33506
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-85133
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81749PEP
Species: Hu
Applications: AC

Publications for DCPS Protein (NBP1-81749PEP) (0)

There are no publications for DCPS Protein (NBP1-81749PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DCPS Protein (NBP1-81749PEP) (0)

There are no reviews for DCPS Protein (NBP1-81749PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DCPS Protein (NBP1-81749PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DCPS Products

Bioinformatics Tool for DCPS Protein (NBP1-81749PEP)

Discover related pathways, diseases and genes to DCPS Protein (NBP1-81749PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DCPS Protein (NBP1-81749PEP)

Discover more about diseases related to DCPS Protein (NBP1-81749PEP).
 

Pathways for DCPS Protein (NBP1-81749PEP)

View related products by pathway.

PTMs for DCPS Protein (NBP1-81749PEP)

Learn more about PTMs related to DCPS Protein (NBP1-81749PEP).
 

Research Areas for DCPS Protein (NBP1-81749PEP)

Find related products by research area.

Blogs on DCPS

There are no specific blogs for DCPS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DCPS Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DCPS