DCP2 Antibody [DyLight 405]

Product Discontinued

DCP2 Antibody [DyLight 405] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human DCP2 (NP_001229306.1).
  
  Sequence:
  METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DCP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for DCP2 Antibody [DyLight 405]

• DCP2 decapping enzyme homolog (S. cerevisiae)
• EC 3.-
• FLJ33245
• hDpc
• mRNA-decapping enzyme 2
• nudix (nucleoside diphosphate linked moiety X)-type motif 20
• Nudix motif 20
• NUDT20Nucleoside diphosphate-linked moiety X motif 20

Background

DCP2 is a key component of an mRNA-decapping complex required for removal of the 5-prime cap from mRNA prior to its degradation from the 5-prime end (Fenger-Gron et al., 2005 [PubMed 16364915]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DCP2