Home » DC-SCRIPT/ZNF366 » DC-SCRIPT/ZNF366 Proteins » DC-SCRIPT/ZNF366 Recombinant Protein Antigen

DC-SCRIPT/ZNF366 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DC-SCRIPT/ZNF366 Protein (NBP1-81921PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

DC-SCRIPT/ZNF366 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF366.

Source: E.coli

Amino Acid Sequence: DLAVKKTPSFPHCLQPVASRGKAPQRHPFPEALRGPFSQFRYEPPPGDLDGFPGVFEGAGSRKRKSMPTKMPYNH
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZNF366
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81921.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for DC-SCRIPT/ZNF366 Recombinant Protein Antigen

  • DCSCRIPT
  • DC-SCRIPT
  • FLJ39796
  • zinc finger protein 366
  • ZNF366

Background

ZNF366 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Doublecortin
Antibody
NBP1-72042
Western Blot: Doublecortin Antibody [NBP1-72042] - staining of Mouse fetal Brain lysate (35 ug protein in RIPA buffer). Antibody at 0.01 ug/mL. Primary incubation was 1 hour. Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody [NBP1-72042] - Immunofluorescence analysis of paraformaldehyde fixed HepG2 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (5 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL).
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody [NBP1-72042] - Immunofluorescence analysis of paraformaldehyde fixed KNRK cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(8 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
IL-4 [Unconjugated]
6507-IL/CF
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.05-0.2 ng/mL.
(3 Publications)
Species: Hu
Applications: BA
IL-10 [Biotin]
DY417
(265 Publications)
Species: Mu
Applications: ELISA
RIP140 Antibody
NBP2-13674
Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human duodenum shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human cerebellum shows moderate nuclear positivity in cells in granular layer.
Immunohistochemistry-Paraffin: RIP140 Antibody [NBP2-13674] - Staining of human skeletal muscle shows weak nuclear positivity in myocytes.
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Progesterone R/NR3C3 was detected in immersion fixed T47D human breast cancer cell line using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 1.7 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Progesterone R/NR3C3 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of T47D human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) followed by HRP‑conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for PR-A and PR-B at approximately 90 and 118 kDa, respectively (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
CtBP1 Antibody
(2G7)
H00001487-M01
Western Blot: CtBP1 Antibody (2G7) [H00001487-M01] - CTBP1 monoclonal antibody (M01), clone 2G7 Analysis of CTBP1 expression in HL-60.
Immunocytochemistry/Immunofluorescence: CtBP1 Antibody (2G7) [H00001487-M01] - Analysis of monoclonal antibody to CTBP1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: CtBP1 Antibody (2G7) [H00001487-M01] - Analysis of monoclonal antibody to CTBP1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(2 Reviews)
(8 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-Page: Recombinant Human PRH2 Protein [H00005555-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
RAR alpha/NR1B1
Antibody (763)
NB200-322
Western Blot: Retinoic Acid Receptor alpha Antibody (763) [NB200-322] - Analysis of hippocampal lysate showing specific immunolabeling of the ~48k RAR-a protein.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
GATA-1 Antibody
(4F5)
NBP1-47492
Immunohistochemistry: GATA-1 Antibody (4F5) [NBP1-47492] - Staining of Fetal Baboon Liver. Antigen retrieval: 10mM sodium citrate, pH 6.0, Primary Ab: 1:500 dilution, Secondary Ab (biotinylated): 1:200, Streptavidin-AlexaFluor488: 1:500 (green), Quench autofluorescence with 1% Sudan Black in 70% methanol. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: GATA-1 Antibody (4F5) [NBP1-47492] - Analysis of K562(left) cells using GATA1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry-Paraffin: GATA-1 Antibody (4F5) [NBP1-47492] - Analysis of pancreatic cancer, using GATA1 mouse mAb with DAB staining.
(1 Review)
(2 Publications)
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
MID1 Antibody
NBP3-05061
Immunocytochemistry/Immunofluorescence: MID1 Antibody [NBP3-05061] - Analysis of MCF-7 cells using MID1 antibody . Blue: DAPI for nuclear staining.
Western Blot: MID1 Antibody [NBP3-05061] - analysis of extracts of HeLa cells, using MID1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 60s.
Species: Hu, Mu
Applications: ICC/IF, WB
MTHFR Antibody
(5D3)
NBP2-37607
Immunohistochemistry-Paraffin: MTHFR Antibody (5D3) [NBP2-37607] - Analysis of intima cancer tissues (left) and prostate tissues (right) using MTHFR mouse mAb with DAB staining.
ELISA: MTHFR Antibody (5D3) [NBP2-37607] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: MTHFR Antibody (5D3) [NBP2-37607] - Western blot analysis using MTHFR mAb against HEK293 (1) and MTHFR(AA: 339-499)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
c-Rel Antibody
[Unconjugated]
AF2699
Western blot shows lysates of Raji human Burkitt's lymphoma cell line, A20 mouse B cell lymphoma cell line, and CH‑1 mouse B cell lymphoma cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse c-Rel Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2699) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for c-Rel at approximately 69 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Jurkat human acute T cell leukemia cell line treated with 50 ng/mL and 200 ng/mL PMA and calcium ionomycin for overnight was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. c‑Rel/DNA complexes were immuno­precipitated using 5 μg Goat Anti-Human/Mouse c‑Rel Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2699) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The p21 promoter was detected by standard PCR.
Simple Western lane view shows lysates of CH‑1 mouse B cell lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for c‑Rel at approximately 71 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse c‑Rel Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2699) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, Simple Western, WB
HMBS Antibody
NBP2-33600
Immunohistochemistry-Paraffin: HMBS Antibody [NBP2-33600] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: HMBS Antibody [NBP2-33600] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: HMBS Antibody [NBP2-33600] - Staining in human bone marrow and cerebral cortex tissues using anti-HMBS antibody. Corresponding HMBS RNA-seq data are presented for the same tissues.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PTPRD Antibody
NBP2-49153
Immunocytochemistry/Immunofluorescence: PTPRD Antibody [NBP2-49153] - Staining of human cell line RH-30 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells in medulla.
Immunohistochemistry-Paraffin: PTPRD Antibody [NBP2-49153] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for DC-SCRIPT/ZNF366 Protein (NBP1-81921PEP) (0)

There are no publications for DC-SCRIPT/ZNF366 Protein (NBP1-81921PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DC-SCRIPT/ZNF366 Protein (NBP1-81921PEP) (0)

There are no reviews for DC-SCRIPT/ZNF366 Protein (NBP1-81921PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DC-SCRIPT/ZNF366 Protein (NBP1-81921PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DC-SCRIPT/ZNF366 Products

Bioinformatics Tool for DC-SCRIPT/ZNF366 Protein (NBP1-81921PEP)

Discover related pathways, diseases and genes to DC-SCRIPT/ZNF366 Protein (NBP1-81921PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DC-SCRIPT/ZNF366 Protein (NBP1-81921PEP)

Discover more about diseases related to DC-SCRIPT/ZNF366 Protein (NBP1-81921PEP).
 

Pathways for DC-SCRIPT/ZNF366 Protein (NBP1-81921PEP)

View related products by pathway.

Blogs on DC-SCRIPT/ZNF366

There are no specific blogs for DC-SCRIPT/ZNF366, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Human mature dentritic cells differentated from human peripheral blood mononuclear cell derived CD14+ cells treated with 20 ng/mL Recombinant Human IL‑4 (Catalog # 204-IL) and 50 ng/mL Recombinant Human GM‑CSF (Catalog # 215-GM) for 7 days and 1 μg/mL LPS, 20 ng/mL Recombinant Human TNF‑ alpha (Catalog # 210-TA), and 20 ng/mL Recombinant Human IL‑1 beta /IL‑1F2 (Catalog # 201-LB) for last 24 hours were stained with Human DC‑SCRIPT/ZNF366 Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF4707, filled histogram), or control antibody (Catalog # AB-108-C, open histogram), followed by Donkey Anti-Goat IgG (H+L) Phycoerythrin (Catalog # F0107). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
DC-SCRIPT/ZNF366 Antibody
AF4707

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DC-SCRIPT/ZNF366 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ZNF366